CF503824

Overview
NameCF503824
Unique NameCF503824
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length303
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: PLST3_ARATH (Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 9.422e-38
Identity = 74/100 (74.00%), Postives = 87/100 (87.00%), Query Frame = 2
Query:    2 FSGWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLPAKEILGW 301
            FSG +ADG+GRRRAFQL ALPMI+GAS+SA T++L GMLLGR  VG GMGIGP+V ALYV+EVSPAYVRG YGSSTQIA C+G+L +LF G+PAK+ LGW
Sbjct:  112 FSGLVADGVGRRRAFQLSALPMIVGASVSASTESLMGMLLGRFLVGIGMGIGPSVTALYVTEVSPAYVRGTYGSSTQIATCIGLLGSLFAGIPAKDNLGW 211          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: PLST2_ARATH (Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.663e-34
Identity = 67/100 (67.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:    2 FSGWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLPAKEILGW 301
            FSG +ADG GRRRAFQ+CALPMI+GA +S ++ +L  MLLGR  VGTGMG+GP VAALYV+EVSPA+VRG YGS  QIA CLG++ ALF+G+P   I GW
Sbjct:  109 FSGGVADGFGRRRAFQICALPMILGAFVSGVSNSLAVMLLGRFLVGTGMGLGPPVAALYVTEVSPAFVRGTYGSFIQIATCLGLMAALFIGIPVHNITGW 208          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: PLST4_ARATH (Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.511e-19
Identity = 48/99 (48.48%), Postives = 64/99 (64.65%), Query Frame = 2
Query:    8 GWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLP-AKEILGW 301
            G +AD  GR R FQL A+P+ IGA + A  +++  M++GRL  G G+GI  A+  LY+SE+SP  +RGA GS  Q+  C+GIL AL  GLP A   L W
Sbjct:  165 GALADKFGRTRTFQLDAIPLAIGAFLCATAQSVQTMIVGRLLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICIGILAALIAGLPLAANPLWW 263          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: PLST1_ARATH (Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 7.020e-17
Identity = 40/99 (40.40%), Postives = 63/99 (63.64%), Query Frame = 2
Query:    5 SGWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLPAKEILGW 301
            +G + D  G RR FQ+  +P+I+GA +SA   +L  +L GR  VG G+G+   +  +Y+SEV+P   RG+ G+  QI  CLGI+ +L +G+PA++   W
Sbjct:  138 AGPLVDKFGYRRTFQIFTIPLILGALVSAQAHSLDEILCGRFLVGLGIGVNTVLVPIYISEVAPTKYRGSLGTLCQIGTCLGIIFSLLLGIPAEDDPHW 236          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: GTR8_BOVIN (Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 4.259e-14
Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 2
Query:    8 GWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVG 274
            GW+ D  GR+ +  LCALP + G ++    +NLW +L GRL  G   GI   VA +Y+SE++   VRG  GS  Q+    GIL+A   G
Sbjct:   88 GWLLDRAGRKLSLVLCALPFVAGFAVITAAQNLWMLLGGRLLTGLACGIASLVAPVYISEIAYPEVRGLLGSCVQLMVVTGILLAYLAG 176          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: GTR8_HUMAN (Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=2 SV=3)

HSP 1 Score: 72.0182 bits (175), Expect = 1.049e-12
Identity = 32/89 (35.96%), Postives = 52/89 (58.43%), Query Frame = 2
Query:    8 GWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVG 274
            GW+ D  GR+ +  LC++P + G ++    +++W +L GRL  G   G+   VA +Y+SE++   VRG  GS  Q+   +GIL+A   G
Sbjct:   88 GWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAG 176          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: STP14_ARATH (Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.052e-12
Identity = 32/91 (35.16%), Postives = 54/91 (59.34%), Query Frame = 2
Query:   29 GRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGLPAKEILGW 301
            GRR +  + ++   +G  ++A  KN+  ++LGR+F+G G+G G     LY+SE++PA +RG      Q+  C+GILVA  +    ++I  W
Sbjct:  111 GRRGSILVGSVSFFLGGVINAAAKNILMLILGRIFLGIGIGFGNQAVPLYLSEMAPAKIRGTVNQLFQLTTCIGILVANLINYKTEQIHPW 201          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: GTR8_RAT (Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.052e-12
Identity = 32/89 (35.96%), Postives = 50/89 (56.18%), Query Frame = 2
Query:    8 GWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVG 274
            GW+ D  GR+ +  LC +P + G ++    +++W +L GRL  G   G+   VA +Y+SE++   VRG  GS  Q+    GIL+A   G
Sbjct:   88 GWLLDRAGRKLSLLLCTVPFVTGFAVITAARDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVTGILLAYVAG 176          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: GTR8_MOUSE (Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.986e-12
Identity = 32/89 (35.96%), Postives = 50/89 (56.18%), Query Frame = 2
Query:    8 GWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVG 274
            GW+ D  GR+ +  LC +P + G ++    +++W +L GRL  G   G+   VA +Y+SE++   VRG  GS  Q+    GIL+A   G
Sbjct:   88 GWLLDRSGRKLSLLLCTVPFVTGFAVITAARDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVTGILLAYVAG 176          
BLAST of CF503824 vs. ExPASy Swiss-Prot
Match: ERDL4_ARATH (Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.375e-11
Identity = 33/91 (36.26%), Postives = 56/91 (61.54%), Query Frame = 2
Query:    5 SGWIADGIGRRRAFQLCALPMIIGASMSAITKNLWGMLLGRLFVGTGMGIGPAVAALYVSEVSPAYVRGAYGSSTQIAACLGILVALFVGL 277
            SG IA+ +GR+ +  + A+P IIG    +  K+   + +GRL  G G+GI      +Y++E++P  +RGA GS  Q++  +GI++A  +GL
Sbjct:  106 SGQIAEYVGRKGSLMIAAIPNIIGWLSISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQTMRGALGSVNQLSVTIGIMLAYLLGL 196          
The following BLAST results are available for this feature:
BLAST of CF503824 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PLST3_ARATH9.422e-3874.00Probable plastidic glucose transporter 3 OS=Arabid... [more]
PLST2_ARATH1.663e-3467.00Probable plastidic glucose transporter 2 OS=Arabid... [more]
PLST4_ARATH1.511e-1948.48Plastidic glucose transporter 4 OS=Arabidopsis tha... [more]
PLST1_ARATH7.020e-1740.40Probable plastidic glucose transporter 1 OS=Arabid... [more]
GTR8_BOVIN4.259e-1441.57Solute carrier family 2, facilitated glucose trans... [more]
GTR8_HUMAN1.049e-1235.96Solute carrier family 2, facilitated glucose trans... [more]
STP14_ARATH3.052e-1235.16Sugar transport protein 14 OS=Arabidopsis thaliana... [more]
GTR8_RAT3.052e-1235.96Solute carrier family 2, facilitated glucose trans... [more]
GTR8_MOUSE3.986e-1235.96Solute carrier family 2, facilitated glucose trans... [more]
ERDL4_ARATH3.375e-1136.26Sugar transporter ERD6-like 4 OS=Arabidopsis thali... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-311 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_B12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503824 ID=CF503824|Name=CF503824|organism=Citrus sinensis|type=EST|length=303bp
GTTCAGTGGTTGGATTGCAGATGGTATTGGACGGCGCAGGGCATTCCAGC
TGTGCGCTTTACCAATGATAATTGGGGCTTCAATGAGTGCTATAACGAAA
AATCTCTGGGGAATGCTTCTTGGAAGGTTATTTGTTGGGACTGGAATGGG
TATTGGGCCTGCTGTTGCAGCTCTCTATGTGTCAGAGGTTTCACCAGCTT
ATGTAAGGGGTGCTTATGGCAGCTCTACCCAGATCGCAGCATGTCTTGGA
ATTTTGGTGGCGTTATTTGTTGGACTCCCAGCTAAGGAAATTTTGGGTTG
GTG
back to top