CF503858

Overview
NameCF503858
Unique NameCF503858
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length442
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6974 contig Csv1_Contig6974:1063..1503. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503858 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 4.765e-48
Identity = 71/110 (64.55%), Postives = 87/110 (79.09%), Query Frame = 1
Query:  112 VAIGAFTAMAQGIFVSCSAGNGGPYANSISNVAPWITTVGAGTLDRNFPTYVSLGNGKSFSGVSLYSRRPLSGSMVPIVDAANVSSTSSGNLCMTGSLIPAKVAGKIVVC 441
            VAIGAF AM +GI VSCSAGN GP ++S+SNVAPWITTVGAGTLDR+FP    LGNGK+F+GVSL+    L   ++P + A N S+ ++GNLCMTG+LIP KV GKIV+C
Sbjct:  294 VAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMC 403          

HSP 2 Score: 60.4622 bits (145), Expect = 4.765e-48
Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 3
Query:    3 CFGSDILAGMDKAIEDGVNVMSMSIGGGLTDYYRD 107
            CF SDILA +DKAI D VNV+SMS+GGG++DYYRD
Sbjct:  258 CFSSDILAAIDKAIADNVNVLSMSLGGGMSDYYRD 292          
BLAST of CF503858 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.471e-18
Identity = 49/113 (43.36%), Postives = 69/113 (61.06%), Query Frame = 1
Query:  112 VAIGAFTAMAQGIFVSCSAGNGGPYANSISNVAPWITTVGAGTLDRNFPTYVSLGNGKSFS--GVSLYSRRPLSGSMVPIVDAA-NVSSTSSGNLCMTGSLIPAKVAGKIVVC 441
            +++G+F AM +GI    SAGN GP + +++N  PWI TV A  +DR F + + LGNGKSFS  G+S++S +  S  +V  VDAA N         C + SL   KV GK++VC
Sbjct:  293 ISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGIDRTFKSKIDLGNGKSFSGMGISMFSPKAKSYPLVSGVDAAKNTDDKYLARYCFSDSLDRKKVKGKVMVC 405          
BLAST of CF503858 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.774e-17
Identity = 46/114 (40.35%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  112 VAIGAFTAMAQGIFVSCSAGNGGPYANSISNVAPWITTVGAGTLDRNFPTYVSLGNGKSFSGVSLYSRRPLSGSMVPIVDAANVSST----SSGNLCMTGSLIPAKVAGKIVVC 441
            +AIG+F A+ +GI  S SAGNGGP   + ++++PW+ +V A T+DR F T V +GNG+SF GVS+           P+V   ++ +T    S+   C   S+ P  + GKIVVC
Sbjct:  287 IAIGSFHAVERGILTSNSAGNGGPNFFTTASLSPWLLSVAASTMDRKFVTQVQIGNGQSFQGVSI---NTFDNQYYPLVSGRDIPNTGFDKSTSRFCTDKSVNPNLLKGKIVVC 397          
The following BLAST results are available for this feature:
BLAST of CF503858 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SUBL_ARATH4.765e-4864.55Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
XSP1_ARATH1.471e-1843.36Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
CUCM1_CUCME2.774e-1740.35Cucumisin OS=Cucumis melo PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-345 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_E11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503858 ID=CF503858|Name=CF503858|organism=Citrus sinensis|type=EST|length=442bp
GTTGTTTTGGCTCTGATATACTAGCAGGCATGGATAAGGCCATTGAAGAT
GGCGTGAATGTTATGTCCATGTCTATTGGGGGAGGACTAACAGATTACTA
CAGAGACACCCGTTGCCATTGGAGCTTTCACTGCTATGGCACAGGGAATT
TTTGTTTCATGCTCAGCTGGAAATGGTGGGCCTTATGCAAACAGCATATC
TAACGTTGCACCTTGGATCACCACCGTAGGAGCTGGAACTTTGGACCGTA
ATTTCCCAACCTATGTTAGCCTTGGAAATGGAAAGAGCTTCTCTGGCGTC
TCGCTTTATAGTAGGAGACCATTATCTGGTTCCATGGTGCCAATAGTTGA
TGCAGCAAATGTTAGTAGTACATCAAGTGGGAATCTCTGCATGACTGGCA
GCTTGATTCCAGCAAAAGTTGCAGGAAAAATTGTGGTCTGTG
back to top