CF503859

Overview
NameCF503859
Unique NameCF503859
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length361
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB3C_ARATH (ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.095e-45
Identity = 88/118 (74.58%), Postives = 99/118 (83.90%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            KAPLIQHF+ET+SG+TTIRSF QE RF   NM L DGYSRP F+ A AMEWL FRLDMLS++TF FSLVFL+SIP G IDP++AGLAVTYGL+LN LQA LIW  C +ENKIISVERI
Sbjct: 1123 KAPLIQHFSETISGATTIRSFSQEFRFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPSLAGLAVTYGLSLNTLQAWLIWTLCNLENKIISVERI 1240          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB9C_ARATH (ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.718e-39
Identity = 74/118 (62.71%), Postives = 99/118 (83.90%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            +AP++ HFAE+++G+TTIR+FDQ  RFI +N+ L+D +SRP FHVA+AMEWL FRL++LS+  FAFSLV L+++P+G I+P+IAGL VTYGL+LN LQA +IW  C  ENK+ISVERI
Sbjct: 1093 RAPILHHFAESLAGATTIRAFDQRDRFISSNLVLIDSHSRPWFHVASAMEWLSFRLNLLSHFVFAFSLVLLVTLPEGVINPSIAGLGVTYGLSLNVLQATVIWNICNAENKMISVERI 1210          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB15C_ARATH (Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.718e-39
Identity = 74/118 (62.71%), Postives = 99/118 (83.90%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            +AP++ HFAE+++G+TTIR+FDQ  RFI +N+ L+D +SRP FHVA+AMEWL FRL++LS+  FAFSLV L+++P+G I+P+IAGL VTYGL+LN LQA +IW  C  ENK+ISVERI
Sbjct:  640 RAPILHHFAESLAGATTIRAFDQRDRFISSNLVLIDSHSRPWFHVASAMEWLSFRLNLLSHFVFAFSLVLLVTLPEGVINPSIAGLGVTYGLSLNVLQATVIWNICNAENKMISVERI 757          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB7C_ARATH (ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.231e-37
Identity = 75/118 (63.56%), Postives = 92/118 (77.97%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            ++PL+QHF+ET+SG TTIRSFDQE RF    M L D YSR  FH  +AMEWL FRLD+LS + FA SLV L+S+P+G I+P+ AGLAVTY L LN+LQA LIW  C +ENK+ISVER+
Sbjct: 1095 RSPLVQHFSETLSGITTIRSFDQEPRFRTDIMRLNDCYSRLRFHAISAMEWLCFRLDLLSTVAFALSLVILVSVPEGVINPSFAGLAVTYALNLNSLQATLIWTLCDLENKMISVERM 1212          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB6C_ARATH (ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 4.379e-35
Identity = 71/118 (60.17%), Postives = 88/118 (74.58%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            ++P++ HF+ET+SG TTIRSFDQE RF    M L D YSR  FH   AMEWL FRL++LS   FA SLV L+S P+G I+P++AGLA+TY L LN LQA LIW  C +ENK+ISVER+
Sbjct: 1073 RSPVVHHFSETLSGITTIRSFDQEPRFRGDIMRLSDCYSRLKFHSTGAMEWLCFRLELLSTFAFASSLVILVSAPEGVINPSLAGLAITYALNLNTLQATLIWTLCDLENKMISVERM 1190          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB5C_ARATH (ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 1.234e-29
Identity = 62/119 (52.10%), Postives = 85/119 (71.43%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERIF 359
            K+P+I  F E+++G+ TIR F QE RFI  N+ L+D + RP F   AA+EWL  R+++LS + FAF +V L+S P G IDP++AGLAVTYGL LN   +  I   C++ENKIIS+ERI+
Sbjct: 1122 KSPIIHLFGESIAGAATIRGFGQEKRFIKRNLYLLDCFVRPFFCSIAAIEWLCLRMELLSTLVFAFCMVLLVSFPHGTIDPSMAGLAVTYGLNLNGRLSRWILSFCKLENKIISIERIY 1240          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB14C_ARATH (ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 4.251e-22
Identity = 47/118 (39.83%), Postives = 78/118 (66.10%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            KAP+I HF+E+++G  TIR+F ++  F   N++ ++   R  FH   + EWLGFRL+++ +     S +F++ +P   I P   GL+++YGL+LN +    I+L+C +ENK++SVERI
Sbjct: 1151 KAPVIHHFSESIAGVMTIRAFKKQPMFRQENVKRVNANLRMDFHNNGSNEWLGFRLELIGSWVLCISALFMVMLPSNIIKPENVGLSLSYGLSLNGVLFWAIYLSCFIENKMVSVERI 1268          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB4C_ARATH (ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 7.252e-22
Identity = 47/118 (39.83%), Postives = 79/118 (66.95%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            KAP+I HF+E+++G  TIRSF ++  F   N++ ++   R  FH   + EWLGFRL+++ +     S +F++ +P   I P   GL+++YGL+LN++    I+++C +ENK++SVERI
Sbjct: 1128 KAPIIHHFSESIAGVMTIRSFRKQELFRQENVKRVNDNLRMDFHNNGSNEWLGFRLELVGSWVLCISALFMVLLPSNVIRPENVGLSLSYGLSLNSVLFFAIYMSCFVENKMVSVERI 1245          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB8C_ARATH (ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 7.505e-19
Identity = 50/118 (42.37%), Postives = 68/118 (57.63%), Query Frame = 3
Query:    3 KAPLIQHFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            KAP++ + AET  G  TIR+F    RF    + L+D  +   F   AAMEW+  R++ L N+T     + LI IPKG+I P + GL+++Y LTL   Q  L    C + N IISVERI
Sbjct:  899 KAPVMNYAAETSLGVVTIRAFGTAERFFKNYLNLVDADAVLFFLSNAAMEWVILRIETLQNVTLFTCALLLILIPKGYIAPGLVGLSLSYALTLTQTQVFLTRWYCTLSNSIISVERI 1016          
BLAST of CF503859 vs. ExPASy Swiss-Prot
Match: AB10C_ARATH (ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.118e-17
Identity = 46/112 (41.07%), Postives = 67/112 (59.82%), Query Frame = 3
Query:   21 HFAETVSGSTTIRSFDQESRFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPAIAGLAVTYGLTLNNLQAMLIWLACQMENKIISVERI 356
            H AE+V+G+ TIR+FD+E RF   ++ L+D  + P FH  AA EWL  RL+ +S I  A +   +I +P G       G+A++YGL+LN      +   C + N IISVER+
Sbjct: 1003 HLAESVAGAITIRAFDEEERFFKKSLTLIDTNASPFFHSFAANEWLIQRLETVSAIVLASTAFCMILLPTGTFSSGFIGMALSYGLSLNMGLVYSVQNQCYLANWIISVERL 1114          
The following BLAST results are available for this feature:
BLAST of CF503859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
AB3C_ARATH2.095e-4574.58ABC transporter C family member 3 OS=Arabidopsis t... [more]
AB9C_ARATH1.718e-3962.71ABC transporter C family member 9 OS=Arabidopsis t... [more]
AB15C_ARATH1.718e-3962.71Putative ABC transporter C family member 15 OS=Ara... [more]
AB7C_ARATH1.231e-3763.56ABC transporter C family member 7 OS=Arabidopsis t... [more]
AB6C_ARATH4.379e-3560.17ABC transporter C family member 6 OS=Arabidopsis t... [more]
AB5C_ARATH1.234e-2952.10ABC transporter C family member 5 OS=Arabidopsis t... [more]
AB14C_ARATH4.251e-2239.83ABC transporter C family member 14 OS=Arabidopsis ... [more]
AB4C_ARATH7.252e-2239.83ABC transporter C family member 4 OS=Arabidopsis t... [more]
AB8C_ARATH7.505e-1942.37ABC transporter C family member 8 OS=Arabidopsis t... [more]
AB10C_ARATH4.118e-1741.07ABC transporter C family member 10 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-346 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_F01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503859 ID=CF503859|Name=CF503859|organism=Citrus sinensis|type=EST|length=361bp
GCAAAGCTCCATTAATACAGCATTTTGCAGAAACTGTTTCCGGGTCAACC
ACTATCAGGAGCTTTGATCAAGAATCAAGGTTTATAGACACAAACATGGA
ACTGATGGATGGATATTCTCGACCAACATTCCATGTTGCTGCTGCCATGG
AATGGCTTGGCTTTCGCCTGGATATGTTGTCTAACATCACATTTGCCTTC
TCTTTGGTTTTCTTAATCTCCATTCCGAAGGGATTTATTGATCCAGCAAT
TGCTGGCCTAGCTGTGACATATGGACTCACCCTAAATAACTTACAAGCTA
TGTTAATATGGCTTGCTTGCCAAATGGAGAACAAGATTATATCAGTTGAG
AGAATTTTTCA
back to top