CF503868

Overview
NameCF503868
Unique NameCF503868
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC5_NICSY (33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.311e-39
Identity = 77/117 (65.81%), Postives = 92/117 (78.63%), Query Frame = 2
Query:    2 SYQGFVDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAPPVLPAAKETKTENSIDGSELLSSIST 352
            +YQGFVDSPHK+Y  NL W LTSQGLRDAF  QPG +SAKVI++R +GRSRGFGF+TF +AE + SALD MN VE+EGRPLRLN+A ++AP   P   ET  EN  D SELLSS+S+
Sbjct:  208 TYQGFVDSPHKLYVANLSWALTSQGLRDAFADQPGFMSAKVIYDRSSGRSRGFGFITFSSAEAMNSALDTMNEVELEGRPLRLNVAGQKAPVSSPPVVETSPENDSDNSELLSSLSS 324          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC2_NICPL (31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.728e-19
Identity = 37/84 (44.05%), Postives = 64/84 (76.19%), Query Frame = 2
Query:   17 VDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANER 268
            VDS +++Y GNL WG+    L++ F  Q  ++ AKV+++R +GRSRGFGFVT+ +A+++  A+D++NG++++GR +R++ A ER
Sbjct:  204 VDSSNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIDSLNGIDLDGRSIRVSAAEER 287          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC2_NICSY (29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.770e-19
Identity = 37/84 (44.05%), Postives = 64/84 (76.19%), Query Frame = 2
Query:   17 VDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANER 268
            VDS +++Y GNL WG+    L++ F  Q  ++ AKV+++R +GRSRGFGFVT+ +++++  A+D++NGV+++GR +R++ A ER
Sbjct:  203 VDSSNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSSKEVNDAIDSLNGVDLDGRSIRVSAAEER 286          

HSP 2 Score: 67.0106 bits (162), Expect = 3.366e-11
Identity = 30/74 (40.54%), Postives = 48/74 (64.86%), Query Frame = 2
Query:   32 KIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLN 253
            K++ GNL + + S  L   F+    +   +VI+++ TGRSRGFGFVT  T E++++A    NG E++GR +R+N
Sbjct:   88 KLFVGNLPFSVDSAALAGLFERAGNVEMVEVIYDKLTGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAIRVN 161          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC1_NICSY (29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.411e-17
Identity = 37/88 (42.05%), Postives = 62/88 (70.45%), Query Frame = 2
Query:   11 GFVDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAP 274
            G  DS +++Y GNL WG+    L   F  Q  ++ AKV+++R +GRSRGFGFVT+ +AE++ +A+++++GV++ GR +R++ A  R P
Sbjct:  182 GSFDSSNRVYVGNLAWGVDQDALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRVSPAEARPP 269          

HSP 2 Score: 67.3958 bits (163), Expect = 2.577e-11
Identity = 31/74 (41.89%), Postives = 48/74 (64.86%), Query Frame = 2
Query:   32 KIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLN 253
            KI+ GNL +   S  L + F+    +   +VI+++ TGRSRGFGFVT  + E++++A    NG E++GR LR+N
Sbjct:   88 KIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQQFNGYELDGRALRVN 161          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC1_NICPL (30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.411e-17
Identity = 37/88 (42.05%), Postives = 62/88 (70.45%), Query Frame = 2
Query:   11 GFVDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAP 274
            G  DS +++Y GNL WG+    L   F  Q  ++ AKV+++R +GRSRGFGFVT+ +AE++ +A+++++GV++ GR +R++ A  R P
Sbjct:  188 GSFDSSNRVYVGNLAWGVDQDALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRVSPAEARPP 275          

HSP 2 Score: 67.3958 bits (163), Expect = 2.577e-11
Identity = 36/95 (37.89%), Postives = 54/95 (56.84%), Query Frame = 2
Query:   32 KIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAPPVLPAAKETKTENS 316
            KI+ GNL +   S  L + F+    +   +VI+++ TGRSRGFGFVT  + E++++A    NG E++GR LR+N      PP       +  ENS
Sbjct:   88 KIFVGNLLFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQQFNGYELDGRALRVN----SGPPPEKRENSSFRENS 178          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC2_ARATH (29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP29 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.320e-15
Identity = 33/84 (39.29%), Postives = 60/84 (71.43%), Query Frame = 2
Query:   23 SPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAP 274
            S +++Y GNL WG+    L + F  Q  ++ A+VI++R +GRS+GFGFVT  +++++Q A++++NG +++GR +R++ A  R P
Sbjct:  255 SGNRLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARPP 338          

HSP 2 Score: 72.0182 bits (175), Expect = 1.046e-12
Identity = 33/74 (44.59%), Postives = 48/74 (64.86%), Query Frame = 2
Query:   32 KIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLN 253
            K++ GNL + + S  L   F+    +   +VI+++ TGRSRGFGFVT  TA ++++A    NG E EGRPLR+N
Sbjct:  100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRVN 173          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC1_ARATH (Ribonucleoprotein At2g37220, chloroplastic OS=Arabidopsis thaliana GN=At2g37220 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.725e-15
Identity = 32/84 (38.10%), Postives = 61/84 (72.62%), Query Frame = 2
Query:   23 SPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAP 274
            S +++Y GNL WG+    L   F  Q  ++ A+VI++R +GRS+GFGFVT+++++++Q+A+ +++G +++GR +R++ A  R P
Sbjct:  202 SGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARPP 285          

HSP 2 Score: 68.1662 bits (165), Expect = 1.511e-11
Identity = 30/74 (40.54%), Postives = 48/74 (64.86%), Query Frame = 2
Query:   32 KIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLN 253
            K++ GNL + + S  L   F+    +   +VI+++ TGRSRGFGFVT  +  ++++A    NG E++GRPLR+N
Sbjct:   92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVN 165          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: ROC3_ARATH (31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP31 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.118e-14
Identity = 34/81 (41.98%), Postives = 53/81 (65.43%), Query Frame = 2
Query:   32 KIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAP 274
            ++Y GNL W + +  L   F     ++ A+V+++R TGRSRGFGFVT    ++L  A+ A++G  +EGR +R+N+A ER P
Sbjct:  245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAEERPP 325          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: PUB1_YEAST (Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae GN=PUB1 PE=1 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 4.248e-14
Identity = 36/89 (40.45%), Postives = 57/89 (64.04%), Query Frame = 2
Query:    2 SYQGFVDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANER 268
            S Q   D    ++ G+L   +  + LR+AF+  P  LS  V+++  TG SRG+GFV+F + +D Q+A+D+M G ++ GRPLR+N A +R
Sbjct:  153 SQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241          
BLAST of CF503868 vs. ExPASy Swiss-Prot
Match: GRP_HORVU (Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.463e-14
Identity = 34/83 (40.96%), Postives = 54/83 (65.06%), Query Frame = 2
Query:   20 DSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANER 268
            D  ++ + G L W    Q L++AF     ++ +K+I +R TGRSRGFGFVTF + E ++ A++AMNG +++GR + +N A  R
Sbjct:    3 DVEYRCFVGGLRWATDDQSLQNAFSKYGDVIDSKIITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQDLDGRNITVNEAQSR 85          
The following BLAST results are available for this feature:
BLAST of CF503868 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
ROC5_NICSY1.311e-3965.8133 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC2_NICPL5.728e-1944.0531 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC2_NICSY9.770e-1944.0529 kDa ribonucleoprotein B, chloroplastic OS=Nicot... [more]
ROC1_NICSY1.411e-1742.0529 kDa ribonucleoprotein A, chloroplastic OS=Nicot... [more]
ROC1_NICPL1.411e-1742.0530 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC2_ARATH1.320e-1539.2929 kDa ribonucleoprotein, chloroplastic OS=Arabido... [more]
ROC1_ARATH1.725e-1538.10Ribonucleoprotein At2g37220, chloroplastic OS=Arab... [more]
ROC3_ARATH1.118e-1441.9831 kDa ribonucleoprotein, chloroplastic OS=Arabido... [more]
PUB1_YEAST4.248e-1440.45Nuclear and cytoplasmic polyadenylated RNA-binding... [more]
GRP_HORVU9.463e-1440.96Glycine-rich RNA-binding protein blt801 OS=Hordeum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-355 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_F11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503868 ID=CF503868|Name=CF503868|organism=Citrus sinensis|type=EST|length=412bp
CAGTTACCAGGGCTTTGTCGACAGCCCTCACAAGATCTATGCTGGAAATC
TTGGCTGGGGTCTGACTTCTCAGGGTTTAAGAGATGCTTTTCAGGGCCAG
CCAGGTTTATTGAGTGCCAAGGTTATCTTTGAGAGATACACTGGAAGATC
TCGAGGCTTTGGTTTTGTCACTTTTGAAACAGCAGAGGATTTACAATCTG
CTTTGGATGCCATGAACGGAGTGGAAGTCGAAGGGCGGCCCCTGCGATTG
AATATGGCAAATGAAAGAGCTCCTCCTGTTTTGCCGGCAGCAAAGGAAAC
GAAAACAGAAAACAGCATTGACGGCAGCGAATTGCTTTCTAGCATTAGCA
CATAAAGAAATATGGCATCAGAAATGTTTTAATCTACTAATGGATGGAGT
TTTTGCGGGAAA
back to top