CF503870

Overview
NameCF503870
Unique NameCF503870
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length307
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9975 contig Csv1_Contig9975:23..329. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_SOYBN (UDP-glucose 6-dehydrogenase OS=Glycine max PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.922e-41
Identity = 81/84 (96.43%), Postives = 81/84 (96.43%), Query Frame = 1
Query:   55 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDIS SRI AWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHV EADIVFV
Sbjct:    1 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISKSRIAAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVFEADIVFV 84          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH2_ARATH (Probable UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana GN=UGD2 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.181e-40
Identity = 79/84 (94.05%), Postives = 80/84 (95.24%), Query Frame = 1
Query:   55 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            MVKICCIGAGYVGGPTMAVIALKCP IEVAVVDISV RINAWNSDQLPIYEPGLD +VKQCRGKNLFFSTDVEKHV EADIVFV
Sbjct:    1 MVKICCIGAGYVGGPTMAVIALKCPDIEVAVVDISVPRINAWNSDQLPIYEPGLDDIVKQCRGKNLFFSTDVEKHVREADIVFV 84          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH1_ARATH (Probable UDP-glucose 6-dehydrogenase 1 OS=Arabidopsis thaliana GN=UGD1 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 5.860e-40
Identity = 78/84 (92.86%), Postives = 79/84 (94.05%), Query Frame = 1
Query:   55 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            MVKICCIGAGYVGGPTMAVIALKCP +EVAVVDISV RINAWNSD LPIYEPGLD VVKQCRGKNLFFSTDVEKHV EADIVFV
Sbjct:    1 MVKICCIGAGYVGGPTMAVIALKCPDVEVAVVDISVPRINAWNSDTLPIYEPGLDDVVKQCRGKNLFFSTDVEKHVREADIVFV 84          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_DROME (UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.654e-29
Identity = 56/83 (67.47%), Postives = 68/83 (81.93%), Query Frame = 1
Query:   58 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            +K+CCIGAGYVGGPT AV+ALKCP I + +VD S  RI  WNSD+LPIYEPGLD VVK+CR  NLFFSTD+E  + EAD++F+
Sbjct:    1 MKVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRNVNLFFSTDIETAIKEADLIFI 83          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_CHICK (UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UGDH PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.654e-29
Identity = 56/82 (68.29%), Postives = 68/82 (82.93%), Query Frame = 1
Query:   61 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            KICCIGAGYVGGPT +VIA  CP I+V VVD++ +RINAWNSD LPIYEPGL  VV+ CRG+NLFFST ++  + EAD+VF+
Sbjct:    6 KICCIGAGYVGGPTCSVIAQMCPKIQVTVVDVNEARINAWNSDTLPIYEPGLKEVVESCRGRNLFFSTSIDDAIREADLVFI 87          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_BOVIN (UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 6.078e-29
Identity = 58/82 (70.73%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   61 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            KICCIGAGYVGGPT +VIA  CP I V VVDI+ SRINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDINESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFI 87          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_HUMAN (UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGDH PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.938e-29
Identity = 57/82 (69.51%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   61 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            KICCIGAGYVGGPT +VIA  CP I V VVD++ SRINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFI 87          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_RAT (UDP-glucose 6-dehydrogenase OS=Rattus norvegicus GN=Ugdh PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.768e-28
Identity = 56/82 (68.29%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   61 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            KICCIGAGYVGGPT +VIA  CP I V VVD++ +RINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+
Sbjct:    6 KICCIGAGYVGGPTCSVIARMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIREADLVFI 87          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_MOUSE (UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugdh PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.310e-28
Identity = 56/82 (68.29%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   61 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            KICCIGAGYVGGPT +VIA  CP I V VVD++ +RINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIREADLVFI 87          
BLAST of CF503870 vs. ExPASy Swiss-Prot
Match: UGDH_PONAB (UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGDH PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.955e-27
Identity = 56/82 (68.29%), Postives = 66/82 (80.49%), Query Frame = 1
Query:   61 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFV 306
            KICCIGAGYVGGPT +VIA   P I V VVD++ SRINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMRPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFI 87          
The following BLAST results are available for this feature:
BLAST of CF503870 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
UGDH_SOYBN6.922e-4196.43UDP-glucose 6-dehydrogenase OS=Glycine max PE=2 SV... [more]
UGDH2_ARATH1.181e-4094.05Probable UDP-glucose 6-dehydrogenase 2 OS=Arabidop... [more]
UGDH1_ARATH5.860e-4092.86Probable UDP-glucose 6-dehydrogenase 1 OS=Arabidop... [more]
UGDH_DROME4.654e-2967.47UDP-glucose 6-dehydrogenase OS=Drosophila melanoga... [more]
UGDH_CHICK4.654e-2968.29UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UG... [more]
UGDH_BOVIN6.078e-2970.73UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH ... [more]
UGDH_HUMAN7.938e-2969.51UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGD... [more]
UGDH_RAT1.768e-2868.29UDP-glucose 6-dehydrogenase OS=Rattus norvegicus G... [more]
UGDH_MOUSE2.310e-2868.29UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugd... [more]
UGDH_PONAB1.955e-2768.29UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGD... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-357 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_G01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503870 ID=CF503870|Name=CF503870|organism=Citrus sinensis|type=EST|length=307bp
TTTTGATTTTGAGAAATCGAAGCTCACTGAGGTTATATTGATTAGTAAAG
GAAAATGGTGAAGATCTGCTGCATCGGTGCTGGGTATGTTGGGGGGCCGA
CAATGGCAGTCATTGCACTGAAGTGCCCATCCATTGAAGTGGCTGTTGTT
GATATCTCTGTGTCTCGGATCAATGCCTGGAACAGTGACCAGCTCCCCAT
CTATGAGCCTGGACTTGATGGTGTGGTAAAGCAGTGCCGAGGGAAGAACC
TGTTCTTCAGCACCGATGTTGAGAAGCATGTCTCTGAGGCTGATATTGTC
TTTGTTT
back to top