CF503874

Overview
NameCF503874
Unique NameCF503874
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length350
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10309 contig Csv1_Contig10309:19..368. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: FHIT_DICDI (Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.134e-21
Identity = 46/87 (52.87%), Postives = 62/87 (71.26%), Query Frame = 1
Query:   88 FGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            FGP+ I   ++F++T LS+ALVNL+P+LPGHVLVCP+R   R  DLT +E  DLWL+AQ + + +E +     + FAIQDG  AGQT
Sbjct:    6 FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQT 92          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: FHIT_HUMAN (Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.059e-20
Identity = 48/89 (53.93%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   82 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF DL  DE  DL+ T Q VGT +E +   +SL F++QDGP+AGQT
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQT 91          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: FHIT_BOVIN (Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.359e-20
Identity = 46/89 (51.69%), Postives = 62/89 (69.66%), Query Frame = 1
Query:   82 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF D++ +E  DL+  AQ VGT +E + + +SL F++QDGP+AGQT
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQAAQRVGTVVEKHFQGTSLTFSMQDGPEAGQT 91          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: FHIT_MOUSE (Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 5.256e-20
Identity = 46/89 (51.69%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   82 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            + FG   I P  VF  T LS+ALVN +P++PGHVLVCP R   RF DL  DE  DL+   Q VGT +E + + +S+ F++QDGP+AGQT
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQT 91          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: FHIT_RAT (Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.965e-20
Identity = 45/89 (50.56%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   82 YAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            + FG   I P  VF  T LS+ALVN +P++PGHVL+CP R   RF DL  DE  DL+   Q VGT +E + + +S+ F++QDGP+AGQT
Sbjct:    3 FKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQT 91          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: NFT1_CAEEL (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.439e-17
Identity = 44/101 (43.56%), Postives = 57/101 (56.44%), Query Frame = 1
Query:   46 LFLSPKMSSIEQYAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            L ++ K S      F  F I    +FYSTP S+  VNL+P+  GHVLV P+R   R  DLT  ET DL++ A+ V   LE +H  +S    +QDG  AGQT
Sbjct:  287 LHINEKSSETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHNVTSTTICVQDGKDAGQT 387          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: HNT2_YEAST (Hit family protein 2 OS=Saccharomyces cerevisiae GN=HNT2 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 4.309e-14
Identity = 38/79 (48.10%), Postives = 54/79 (68.35%), Query Frame = 1
Query:  115 QVFYSTPLSYALVNLRPLLPGHVLVCPRRDAV-RFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            QVFY +  +YALVNL+P++PGHVL+ P R  V    DLT  E++D + T Q +   ++  +KA S+  AIQDGP+AGQ+
Sbjct:   15 QVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQS 93          
BLAST of CF503874 vs. ExPASy Swiss-Prot
Match: APH1_SCHPO (Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe GN=aph1 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 5.628e-14
Identity = 43/91 (47.25%), Postives = 53/91 (58.24%), Query Frame = 1
Query:   76 EQYAFGPFKIDPRQVFYSTPLSYALVNLRPLLPGHVLVCPRRDAVRFGDLTADETRDLWLTAQTVGTQLESYHKASSLAFAIQDGPQAGQT 348
            +Q  F  F +   QVFY T LS A VNL+P+LPGHVLV P+R   R  DLT  E  DL+ + + V   +E    AS+    IQDG  AGQT
Sbjct:    3 KQLYFSKFPVGS-QVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASNIGIQDGVDAGQT 92          
The following BLAST results are available for this feature:
BLAST of CF503874 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
FHIT_DICDI2.134e-2152.87Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium d... [more]
FHIT_HUMAN1.059e-2053.93Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN... [more]
FHIT_BOVIN2.359e-2051.69Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=F... [more]
FHIT_MOUSE5.256e-2051.69Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN... [more]
FHIT_RAT8.965e-2050.56Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegic... [more]
NFT1_CAEEL5.439e-1743.56Nitrilase and fragile histidine triad fusion prote... [more]
HNT2_YEAST4.309e-1448.10Hit family protein 2 OS=Saccharomyces cerevisiae G... [more]
APH1_SCHPO5.628e-1447.25Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-361 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_G06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503874 ID=CF503874|Name=CF503874|organism=Citrus sinensis|type=EST|length=350bp
GTTGGTTCATTTCCCATTCATCGAACAGGTCGATCACCTCCTCCACTGTT
TCTGTCGCCAAAGATGTCATCCATCGAGCAATATGCGTTCGGCCCTTTTA
AGATAGATCCTAGGCAAGTGTTCTATTCAACCCCTCTATCCTACGCCTTG
GTCAACTTGCGCCCTCTGCTTCCTGGTCATGTGCTTGTCTGCCCAAGGCG
TGACGCGGTTCGCTTTGGTGATCTTACTGCTGATGAGACCCGTGATTTAT
GGCTCACGGCCCAGACAGTTGGCACACAGCTCGAAAGCTACCACAAGGCT
TCATCACTAGCATTTGCCATTCAAGATGGACCTCAAGCTGGACAGACAGT
back to top