CF503928

Overview
NameCF503928
Unique NameCF503928
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length639
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC5_ARATH (Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana GN=CSLC5 PE=1 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.217e-92
Identity = 147/175 (84.00%), Postives = 156/175 (89.14%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALEESGGWLERTTVEDMDIAVRAHL+GWKFI+LNDVKVLCEVPESYEAY+KQQHRWHSGPMQLFRLCL +I+ SKI  WKK N             PFYSFTLFCIILPLTMF+PEAELPVWVICY+PVFMSFLN+LP+PKSFPFI PYLLFENTMSVTKFNAMVSGLF
Sbjct:  398 GVWRIKALEESGGWLERTTVEDMDIAVRAHLHGWKFIYLNDVKVLCEVPESYEAYKKQQHRWHSGPMQLFRLCLGSILTSKIAIWKKANLILLFFLLRKLILPFYSFTLFCIILPLTMFVPEAELPVWVICYIPVFMSFLNLLPSPKSFPFIVPYLLFENTMSVTKFNAMVSGLF 572          

HSP 2 Score: 48.9062 bits (115), Expect = 1.217e-92
Identity = 24/32 (75.00%), Postives = 24/32 (75.00%), Query Frame = 3
Query:    3 ENLLTRLQNINLSFHFEVEQQVNRSISKLFWF 98
            ENLLTRLQNINL FHFEVEQQVN      F F
Sbjct:  362 ENLLTRLQNINLCFHFEVEQQVNGVFLNFFGF 393          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC4_ARATH (Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana GN=CSLC4 PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.526e-92
Identity = 143/175 (81.71%), Postives = 156/175 (89.14%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFI+LNDV+V CE+PESYEAY+KQQHRWHSGPMQLFRLCLP+IIKSKI  WKK N             PFYSFTLFCIILPLTMFIPEAELP+W+ICYVP+F+S LNILP+PKSFPF+ PYLLFENTMS+TKFNAM+SGLF
Sbjct:  370 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIYLNDVEVTCELPESYEAYKKQQHRWHSGPMQLFRLCLPSIIKSKISVWKKANLIFLFFLLRKLILPFYSFTLFCIILPLTMFIPEAELPLWIICYVPIFISLLNILPSPKSFPFLVPYLLFENTMSITKFNAMISGLF 544          

HSP 2 Score: 48.9062 bits (115), Expect = 3.526e-92
Identity = 24/32 (75.00%), Postives = 24/32 (75.00%), Query Frame = 3
Query:    3 ENLLTRLQNINLSFHFEVEQQVNRSISKLFWF 98
            ENLLTRLQNINL FHFEVEQQVN      F F
Sbjct:  334 ENLLTRLQNINLCFHFEVEQQVNGVFLNFFGF 365          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC2_ORYSJ (Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica GN=CSLC2 PE=2 SV=2)

HSP 1 Score: 310.842 bits (795), Expect = 4.598e-92
Identity = 146/175 (83.43%), Postives = 155/175 (88.57%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRI+ALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCE+PESYEAYRKQQHRWHSGPM LFRLCLP I+ +KI +WKK N             PFYSFTLFC+ILPLTMF+PEAELPVWVICYVPV MSFLNILP+P+SFPFI PYLLFENTMSVTKFNAMVSGLF
Sbjct:  404 GVWRIQALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGPMHLFRLCLPDILTAKISSWKKANLILLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPVWVICYVPVCMSFLNILPSPRSFPFIVPYLLFENTMSVTKFNAMVSGLF 578          

HSP 2 Score: 48.9062 bits (115), Expect = 4.598e-92
Identity = 24/32 (75.00%), Postives = 24/32 (75.00%), Query Frame = 3
Query:    3 ENLLTRLQNINLSFHFEVEQQVNRSISKLFWF 98
            ENLLTRLQNINL FHFEVEQQVN      F F
Sbjct:  368 ENLLTRLQNINLCFHFEVEQQVNGVFLNFFGF 399          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC8_ARATH (Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana GN=CSLC8 PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 4.599e-92
Identity = 145/175 (82.86%), Postives = 155/175 (88.57%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALEESGGWLERTTVEDMDIAVRAHL+GWKFI+LNDVKVLCEVPESYEAY+KQQHRWHSGPMQLFRLCL +I+ SKI  WKK N             PFYSFTLFC+ILP+TMF+PEAELP+WVICYVP+FMS LNILPAPKSFPFI PYLLFENTMSVTKFNAMVSGLF
Sbjct:  398 GVWRIKALEESGGWLERTTVEDMDIAVRAHLHGWKFIYLNDVKVLCEVPESYEAYKKQQHRWHSGPMQLFRLCLRSILTSKIAMWKKANLILLFFLLRKLILPFYSFTLFCVILPITMFVPEAELPIWVICYVPIFMSLLNILPAPKSFPFIVPYLLFENTMSVTKFNAMVSGLF 572          

HSP 2 Score: 48.9062 bits (115), Expect = 4.599e-92
Identity = 24/32 (75.00%), Postives = 24/32 (75.00%), Query Frame = 3
Query:    3 ENLLTRLQNINLSFHFEVEQQVNRSISKLFWF 98
            ENLLTRLQNINL FHFEVEQQVN      F F
Sbjct:  362 ENLLTRLQNINLCFHFEVEQQVNGVFLNFFGF 393          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC2_ORYSI (Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica GN=CSLC2 PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 3.857e-91
Identity = 145/175 (82.86%), Postives = 154/175 (88.00%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRI+ALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCE+PESYEAYRKQQHRWHSGPM LF LCLP I+ +KI +WKK N             PFYSFTLFC+ILPLTMF+PEAELPVWVICYVPV MSFLNILP+P+SFPFI PYLLFENTMSVTKFNAMVSGLF
Sbjct:  404 GVWRIQALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGPMHLFWLCLPDILTAKISSWKKANLILLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPVWVICYVPVCMSFLNILPSPRSFPFIVPYLLFENTMSVTKFNAMVSGLF 578          

HSP 2 Score: 48.9062 bits (115), Expect = 3.857e-91
Identity = 24/32 (75.00%), Postives = 24/32 (75.00%), Query Frame = 3
Query:    3 ENLLTRLQNINLSFHFEVEQQVNRSISKLFWF 98
            ENLLTRLQNINL FHFEVEQQVN      F F
Sbjct:  368 ENLLTRLQNINLCFHFEVEQQVNGVFLNFFGF 399          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC9_ORYSJ (Probable xyloglucan glycosyltransferase 9 OS=Oryza sativa subsp. japonica GN=CSLC9 PE=2 SV=2)

HSP 1 Score: 297.36 bits (760), Expect = 5.053e-88
Identity = 138/175 (78.86%), Postives = 149/175 (85.14%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKAL++SGGW+ERTTVEDMDIAVRAHL GWKFIFLNDV+  CE+PESYEAYRKQQHRWHSGPMQLFRLCLP IIK KI  WKK N             PFYSFTLFCIILP+TMF+PEAELP WV+CY+P  MS LNILP+PKSFPFI PYLLFENTMSVTKFNAM+SGLF
Sbjct:  309 GVWRIKALDDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIKCKIVFWKKANLIFLFFLLRKLILPFYSFTLFCIILPMTMFVPEAELPDWVVCYIPALMSLLNILPSPKSFPFIIPYLLFENTMSVTKFNAMISGLF 483          

HSP 2 Score: 48.9062 bits (115), Expect = 5.053e-88
Identity = 24/32 (75.00%), Postives = 24/32 (75.00%), Query Frame = 3
Query:    3 ENLLTRLQNINLSFHFEVEQQVNRSISKLFWF 98
            ENLLTRLQNINL FHFEVEQQVN      F F
Sbjct:  273 ENLLTRLQNINLCFHFEVEQQVNGIFLNFFGF 304          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLC3_ORYSJ (Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica GN=CSLC3 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 6.689e-86
Identity = 147/175 (84.00%), Postives = 156/175 (89.14%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALE+SGGW+ERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCE+PESY+AYRKQQHRWHSGPMQLFRLCLPA+ KSKI TWKK N             PFYSFTLFC+ILPLTMF+PEAELP+WVICYVPV MS LNILPAPKSFPF+ PYLLFENTMSVTKFNAMVSGLF
Sbjct:  432 GVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYQAYRKQQHRWHSGPMQLFRLCLPAVFKSKISTWKKANLVMLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPIWVICYVPVIMSVLNILPAPKSFPFVIPYLLFENTMSVTKFNAMVSGLF 606          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLCA_ORYSJ (Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. japonica GN=CSLC10 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.860e-82
Identity = 141/175 (80.57%), Postives = 151/175 (86.29%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALE+SGGW+ERTTVEDMDIAVRAHLNGWKF+FLNDV+  CE+PESYEAYRKQQHRWHSGPMQLFRLCLP II+ KI  WKK N             PFYSFTLFCIILP+TMFIPEAELP WV+CY+P  MSFLNILPAPKSFPFI PYLLFENTMSVTKFNAM+SGLF
Sbjct:  399 GVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFVFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRCKIAFWKKANLIFLFFLLRKLILPFYSFTLFCIILPMTMFIPEAELPDWVVCYIPALMSFLNILPAPKSFPFIIPYLLFENTMSVTKFNAMISGLF 573          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLCA_ORYSI (Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica GN=CSLC10 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.860e-82
Identity = 141/175 (80.57%), Postives = 151/175 (86.29%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALE+SGGW+ERTTVEDMDIAVRAHLNGWKF+FLNDV+  CE+PESYEAYRKQQHRWHSGPMQLFRLCLP II+ KI  WKK N             PFYSFTLFCIILP+TMFIPEAELP WV+CY+P  MSFLNILPAPKSFPFI PYLLFENTMSVTKFNAM+SGLF
Sbjct:  399 GVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFVFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRCKIAFWKKANLIFLFFLLRKLILPFYSFTLFCIILPMTMFIPEAELPDWVVCYIPALMSFLNILPAPKSFPFIIPYLLFENTMSVTKFNAMISGLF 573          
BLAST of CF503928 vs. ExPASy Swiss-Prot
Match: CSLCC_ARATH (Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana GN=CSLC12 PE=1 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.305e-81
Identity = 142/175 (81.14%), Postives = 152/175 (86.86%), Query Frame = 2
Query:  113 GVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCEVPESYEAYRKQQHRWHSGPMQLFRLCLPAIIKSKIPTWKKGNXXXXXXXXXXXXXPFYSFTLFCIILPLTMFIPEAELPVWVICYVPVFMSFLNILPAPKSFPFIGPYLLFENTMSVTKFNAMVSGLF 637
            GVWRIKALE+SGGWLERTTVEDMDIAVRAHL+GWKF+FLNDV+  CE+PESYEAYRKQQHRWHSGPMQLFRLCLPA+IKSKI   KK N             PFYSFTLFCIILP+TMF+PEAELP WV+CY+P  MSFLNILPAPKSFPFI PYLLFENTMSVTKFNAMVSGLF
Sbjct:  412 GVWRIKALEDSGGWLERTTVEDMDIAVRAHLHGWKFVFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPAVIKSKISIGKKFNLIFLFFLLRKLILPFYSFTLFCIILPMTMFVPEAELPAWVVCYIPATMSFLNILPAPKSFPFIVPYLLFENTMSVTKFNAMVSGLF 586          
The following BLAST results are available for this feature:
BLAST of CF503928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
CSLC5_ARATH1.217e-9284.00Probable xyloglucan glycosyltransferase 5 OS=Arabi... [more]
CSLC4_ARATH3.526e-9281.71Xyloglucan glycosyltransferase 4 OS=Arabidopsis th... [more]
CSLC2_ORYSJ4.598e-9283.43Probable xyloglucan glycosyltransferase 2 OS=Oryza... [more]
CSLC8_ARATH4.599e-9282.86Probable xyloglucan glycosyltransferase 8 OS=Arabi... [more]
CSLC2_ORYSI3.857e-9182.86Probable xyloglucan glycosyltransferase 2 OS=Oryza... [more]
CSLC9_ORYSJ5.053e-8878.86Probable xyloglucan glycosyltransferase 9 OS=Oryza... [more]
CSLC3_ORYSJ6.689e-8684.00Probable xyloglucan glycosyltransferase 3 OS=Oryza... [more]
CSLCA_ORYSJ5.860e-8280.57Putative xyloglucan glycosyltransferase 10 OS=Oryz... [more]
CSLCA_ORYSI5.860e-8280.57Putative xyloglucan glycosyltransferase 10 OS=Oryz... [more]
CSLCC_ARATH1.305e-8181.14Probable xyloglucan glycosyltransferase 12 OS=Arab... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-416 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_D05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503928 ID=CF503928|Name=CF503928|organism=Citrus sinensis|type=EST|length=639bp
ATGAGAACTTGCTGACACGCCTCCAGAACATTAATTTGTCTTTTCATTTC
GAGGTGGAACAACAGGTTAACCGGAGTATTTCTAAGCTTTTTTGGTTTCA
ACGGAACAGCCTGGCGTCTGGAGAATTAAGGCCCTTGAAGAGTCTGGAGG
ATGGCTTGAAAGAACAACCGTAGAGGACATGGACATAGCTGTTCGTGCTC
ATCTCAATGGTTGGAAATTCATATTCCTTAATGATGTCAAGGTCCTTTGT
GAAGTTCCTGAGTCTTATGAAGCTTATAGAAAGCAGCAACATCGTTGGCA
TTCCGGCCCTATGCAACTTTTCCGCTTGTGTCTTCCAGCAATCATAAAAT
CTAAGATACCGACGTGGAAGAAAGGAAACTTAATACTGCTCTTCTTTCTA
TTGAGGAAACTTATACTTCCTTTCTATTCCTTCACATTGTTCTGCATAAT
TCTTCCTCTAACCATGTTCATACCCGAGGCAGAGCTTCCTGTGTGGGTCA
TTTGTTACGTTCCCGTTTTCATGTCATTCCTCAATATTCTTCCTGCCCCA
AAGTCCTTTCCTTTCATTGGGCCTTACCTCTTATTCGAGAACACTATGTC
AGTGACCAAATTCAATGCAATGGTATCTGGACTATTCCA
back to top