CF503932
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.559e-19 Identity = 48/56 (85.71%), Postives = 49/56 (87.50%), Query Frame = -3 Query: 47 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM----ALLLSP 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM A+L P Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEP 376
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.559e-19 Identity = 48/56 (85.71%), Postives = 49/56 (87.50%), Query Frame = -3 Query: 47 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM----ALLLSP 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM A+L P Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEP 376
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.559e-19 Identity = 48/56 (85.71%), Postives = 49/56 (87.50%), Query Frame = -3 Query: 47 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM----ALLLSP 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM A+L P Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEP 376
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 322 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 367
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2) HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM Sbjct: 321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366 The following BLAST results are available for this feature:
BLAST of CF503932 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 27
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF503932 ID=CF503932; Name=CF503932; organism=Citrus sinensis; type=EST; length=210bpback to top |