CF503932

Overview
NameCF503932
Unique NameCF503932
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length210
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.559e-19
Identity = 48/56 (85.71%), Postives = 49/56 (87.50%), Query Frame = -3
Query:   47 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM----ALLLSP 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM    A+L  P
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEP 376          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.559e-19
Identity = 48/56 (85.71%), Postives = 49/56 (87.50%), Query Frame = -3
Query:   47 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM----ALLLSP 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM    A+L  P
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEP 376          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.559e-19
Identity = 48/56 (85.71%), Postives = 49/56 (87.50%), Query Frame = -3
Query:   47 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM----ALLLSP 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM    A+L  P
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEP 376          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  322 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 367          
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 3.342e-19
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = -3
Query:   65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202
            F VGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM
Sbjct:  321 FLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 366          
The following BLAST results are available for this feature:
BLAST of CF503932 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_TOBAC2.559e-1985.71Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_NICPA2.559e-1985.71Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_HORVU2.559e-1985.71Inositol-3-phosphate synthase OS=Hordeum vulgare P... [more]
INO3_ARATH3.342e-1997.83Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO2_ARATH3.342e-1997.83Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO1_WHEAT3.342e-1997.83Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SPIPO3.342e-1997.83Inositol-3-phosphate synthase OS=Spirodela polyrrh... [more]
INO1_SESIN3.342e-1997.83Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO1_PHAVU3.342e-1997.83Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]
INO1_ORYSJ3.342e-1997.83Inositol-3-phosphate synthase OS=Oryza sativa subs... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-420 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_D09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503932 ID=CF503932|Name=CF503932|organism=Citrus sinensis|type=EST|length=210bp
GTGAACACCCCGACCACGTTGTGGTCATCAAGTATGTGCCATATGTTGGC
GATAGCAAGAGAGCCATGTCATCAACAACATTACTTTTGGAAATCTCCTT
GGAGCGGAAGGTTTGAGGAGCTGAAAGATTCATTCCATCATTGTTTCCCA
AGTGGTTGTAGCTAACAATTGATGTTGGCTTGATTCCTGCCCCAACAAAA
AAAAAAAAAA
back to top