CF503933

Overview
NameCF503933
Unique NameCF503933
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length728
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig508 contig Csv1_Contig508:1..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503933 vs. ExPASy Swiss-Prot
Match: Y3684_ARATH (Acyltransferase-like protein At3g26840, chloroplastic OS=Arabidopsis thaliana GN=At3g26840 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.189e-41
Identity = 84/145 (57.93%), Postives = 103/145 (71.03%), Query Frame = 2
Query:  299 EDEAETKQRVNVREYSEEESEGNG--KSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFLPGIDGVGLGLIRQHQSLGKIFDIWCLHIPVKDRTSFTGLVKLIESTVRSESNRSPKRPVYLGGESLGACIALAVA 727
            ++   T  +V    YS+ E+      K L D+ +EA + +    GGGPPRWFSPLECG+   +SPLLL+LPGIDG GLGLIR H+ LG+IFDIWCLHIPV DRT    LVKLIE TV+SE+ R P RP+YL GES+GAC+AL VA
Sbjct:   59 DENRATVAKVVENPYSKVEAARPDLQKRLSDFLEEAREFV--GDGGGPPRWFSPLECGAQATNSPLLLYLPGIDGTGLGLIRHHKKLGEIFDIWCLHIPVSDRTPVKDLVKLIEETVKSENFRLPNRPIYLVGESIGACLALDVA 201          
BLAST of CF503933 vs. ExPASy Swiss-Prot
Match: Y1457_ARATH (Acyltransferase-like protein At1g54570, chloroplastic OS=Arabidopsis thaliana GN=At1g54570 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.121e-36
Identity = 72/151 (47.68%), Postives = 104/151 (68.87%), Query Frame = 2
Query:  278 KKSSELVEDEAETKQRVNVREYSEEESEGNG-KSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFLPGIDGVGLGLIRQHQSLGKIFDIWCLHIPVKDRTSFTGLVKLIESTVRSESNRSPKRPVYLGGESLGACIALAVA 727
            +K +  V  + ++K+++   E      +G G KS+KDYF  A++++K+   GGPPRWFSP++CG    D+P LLFLPG+DG G+GL+  H++LGK F + CLHIPV DRT F GL+K++E  +R E    P +P+YL G+S G C+ALAVA
Sbjct:   58 QKGANEVNGKGKSKRKIVSDEIELLWDDGYGSKSVKDYFAAAKEILKAD--GGPPRWFSPVDCGRPVEDAPTLLFLPGMDGTGMGLVPHHKALGKAFHVSCLHIPVLDRTPFEGLLKVVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVA 206          
The following BLAST results are available for this feature:
BLAST of CF503933 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
Y3684_ARATH2.189e-4157.93Acyltransferase-like protein At3g26840, chloroplas... [more]
Y1457_ARATH2.121e-3647.68Acyltransferase-like protein At1g54570, chloroplas... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-421 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_D10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503933 ID=CF503933|Name=CF503933|organism=Citrus sinensis|type=EST|length=728bp
CCTCGTGCCGATTCGGCACGAGGATCACAAGTCACAAAAGCGCCACAAAA
CAAACAGAGGGAGAGAGAAATTCTTACTTTGGTTCTAGATGGCGACGGTC
GGAGCTTGCATCTTTTCGGCCGTTTCCTCGCCGGTTTTTCGTCGACAAAT
TATGTCGTCGTCCGAGAAGCCGAAACGGAATCCTATATTGAAGCGAGTAG
CGGTATCAACGGAGCGGACATCAGCTGCAACGACGACAGTGATGACGGAA
ACGACGCCGACGAGGATATTTGTGGAGAAGAAGAGTAGCGAGTTAGTAGA
AGATGAAGCTGAGACGAAACAGAGAGTTAACGTGAGAGAATATTCGGAGG
AGGAGAGTGAAGGTAACGGAAAGAGCTTGAAAGATTACTTTGATGAAGCC
GAAGATATGATCAAATCGTCATCAGGCGGCGGTCCGCCCCGCTGGTTCTC
GCCTTTAGAATGCGGGTCCCACACTCGCGATTCTCCTCTCCTCCTCTTTT
TGCCTGGGATCGACGGTGTTGGACTTGGACTTATAAGACAGCATCAAAGC
CTTGGAAAGATATTTGATATATGGTGCTTGCATATTCCAGTTAAGGATCG
GACATCATTTACAGGTCTAGTAAAGTTGATTGAAAGCACTGTAAGGTCAG
AGAGTAACCGTTCACCAAAGAGGCCCGTATATCTTGGTGGAGAATCTCTT
GGAGCTTGCATTGCACTTGCTGTCGCAG
back to top