CF503936

Overview
NameCF503936
Unique NameCF503936
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length444
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3768 contig Csv1_Contig3768:614..1057. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 261.151 bits (666), Expect = 1.402e-69
Identity = 125/146 (85.62%), Postives = 133/146 (91.10%), Query Frame = 3
Query:    6 MRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            ++GILQFL D GSPF INPYPFFAYQSDPRPETLAFCLF+PNAGRVDS TGIKY NMFDAQVDAVHSAL +MGF+ VEIVVAETGW  RGD NEVG SV+NAKAYNGNLIAHLRSM GTPLMPGK VDTYIFALYDE+LKPGP+SE
Sbjct:  182 LKGILQFLSDTGSPFAINPYPFFAYQSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETGWASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSE 327          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.157e-39
Identity = 80/145 (55.17%), Postives = 100/145 (68.97%), Query Frame = 3
Query:   15 ILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRS--MAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            IL+F +   SPF IN YPFFAY+ +P+   L F LFQPN G VD  TG  Y NM  AQ+DAV+SAL A GFK + + ++ETGWP +GD +EVG + ENAK YNGNLI  + S     TPL P   +  Y+FAL++E+LKPGPTSE
Sbjct:  187 ILEFHRKTDSPFLINAYPFFAYKGNPKEVPLDFVLFQPNQGIVDPATGFHYDNMLFAQIDAVYSALAAAGFKSLRVEISETGWPSKGDDDEVGATPENAKRYNGNLIKMMMSGKKTKTPLKPNNDLSIYVFALFNENLKPGPTSE 331          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500/F10A12.18 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 2.183e-38
Identity = 72/146 (49.32%), Postives = 97/146 (66.44%), Query Frame = 3
Query:    6 MRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            ++ +L F     SPF IN YPFFAY+  P+   L + LFQPN G VD  T + Y NM  AQVDA++SA+  +G  D+E+ ++ETGWP +GD NE+G S ENA  YNGNL+  ++   GTP      +D Y+FAL++E+LKPGP SE
Sbjct:  185 LQPLLDFHSQIESPFLINAYPFFAYKDSPKEVPLEYVLFQPNQGMVDPNTNLHYDNMLFAQVDALYSAIKTLGHTDIEVRISETGWPSKGDENEIGASPENAALYNGNLLKLIQQRKGTPAKQSVPIDVYVFALFNENLKPGPVSE 330          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 7.021e-37
Identity = 67/143 (46.85%), Postives = 101/143 (70.63%), Query Frame = 3
Query:   15 ILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            +LQF +D GSPF +NPYP+F+Y    RPETL + LF+PN+G  D  T + Y +M DAQ+DA+++A+  +G+ DV+I V E GWP + +P ++G  V+ A+ +N  +I    S  GTPLMP ++ +TY+F+L+DE+ KPGP +E
Sbjct:  190 MLQFHRDTGSPFMVNPYPYFSY----RPETLNYALFRPNSGIYDPATKLNYTSMLDAQMDAIYTAMKKLGYGDVDIAVGEAGWPTQAEPGQIGVGVQEARDFNEGMIRVCSSGKGTPLMPNRTFETYLFSLFDENQKPGPIAE 328          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E1310_ARATH (Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis thaliana GN=At5g42100 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.551e-36
Identity = 77/146 (52.74%), Postives = 99/146 (67.81%), Query Frame = 3
Query:   15 ILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMG--FKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRS-MAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            IL F    GSP  IN YPFFAY+ +P+  +L F LFQPN G  D G+   Y NM  AQVDAV+ AL+A+G  +K V IVV+ETGWP  GDP EVG + +NA+ YNGNLI  + S    TP+ P   +  ++FAL++E++KPGPTSE
Sbjct:  185 ILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSE 330          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 5.032e-35
Identity = 67/146 (45.89%), Postives = 99/146 (67.81%), Query Frame = 3
Query:    6 MRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            ++ +L+FL ++ SPF I+ YP++AY+       L + LF+ ++  VD  TG+ Y NMFDAQ+DA++ AL AM FK V+++V E+GWP +G P E   + ENA AYN NLI H+    GTP  PG+ +D Y+F+L++E+ KPG  SE
Sbjct:  182 LKPMLEFLVENESPFMIDLYPYYAYRDSTEKVPLEYALFESSSQVVDPATGLLYSNMFDAQLDAIYFALTAMSFKTVKVMVTESGWPSKGSPKETAATPENALAYNTNLIRHVIGDPGTPAKPGEEIDVYLFSLFNENRKPGIESE 327          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.114e-33
Identity = 65/147 (44.22%), Postives = 102/147 (69.39%), Query Frame = 3
Query:    6 MRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNE-VGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            +R +L+FL ++ SPF I+ YP++AY+  P   +L + LF+ ++  +D  TG+ Y NMFDAQVDA++ AL A+ F+ ++I+V ETGWP +G P E    S +NA+ YN N+I H+ +  GTP  PG++++ YIF+L++E+ K G  SE
Sbjct:  182 LRPMLEFLAENKSPFMIDLYPYYAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVTETGWPTKGSPKEKAAASSDNAETYNSNIIRHVVTNQGTPAKPGEAMNVYIFSLFNENRKAGLDSE 328          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 2.337e-32
Identity = 68/146 (46.58%), Postives = 93/146 (63.70%), Query Frame = 3
Query:   15 ILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQP---NAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            +L+FL+  GSP  +N YP+F Y        L + LFQP   N   VD+ T + Y N+FDA VDA + A++ + F ++ IVV E+GWP +G P+E   +VENA  YN NLI H+ +  GTP  PG +V TYI+ LY+ED +PGP SE
Sbjct:  181 LLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQPLQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSE 326          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E13F_HORVU (Putative glucan endo-1,3-beta-glucosidase GVI (Fragment) OS=Hordeum vulgare PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.957e-27
Identity = 64/143 (44.76%), Postives = 91/143 (63.64%), Query Frame = 3
Query:    3 TMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSAL-NAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKP 428
            T+  I+  L   G+P  +N YP+FAY +DP    L + L   +A    +  G++Y NMFDA +DAV++A+  A G + +E+VV+ETGWP  G     G SVENA AY  NL+ H   + GTP  PGK+V+TYIFA+++E+ KP
Sbjct:  157 TVGPIVSHLASSGTPLLVNVYPYFAYSADPSSVRLDYALLSSSAAVAVTDNGVEYANMFDAILDAVYAAVEKAGGGESLELVVSETGWPSGG--GGYGASVENAAAYINNLVRH---VGGTPRRPGKAVETYIFAMFNENQKP 294          
BLAST of CF503936 vs. ExPASy Swiss-Prot
Match: E13A_ARATH (Glucan endo-1,3-beta-glucosidase, acidic isoform OS=Arabidopsis thaliana GN=BG2 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 5.043e-27
Identity = 65/143 (45.45%), Postives = 90/143 (62.94%), Query Frame = 3
Query:   15 ILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSE 443
            ++ FL    SP  +N YP+F+Y  D     L + LF   +  VD+  G  Y N+FDA +D+V++AL   G   +EIVV+ETGWP  G    VG SVENAK Y  NLI H+++  G+P  PGK+++TYIFA++DE+ K  PT E
Sbjct:  185 VIGFLASKQSPLLVNLYPYFSYMGDTANIHLDYALFTAQS-TVDNDPGYSYQNLFDANLDSVYAALEKSGGGSLEIVVSETGWPTEG---AVGTSVENAKTYVNNLIQHVKN--GSPRRPGKAIETYIFAMFDEN-KKEPTYE 320          
The following BLAST results are available for this feature:
BLAST of CF503936 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
E137_ARATH1.402e-6985.62Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E1311_ARATH1.157e-3955.17Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis... [more]
E1314_ARATH2.183e-3849.32Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis... [more]
E13B_WHEAT7.021e-3746.85Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E1310_ARATH4.551e-3652.74Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis... [more]
E1312_ARATH5.032e-3545.89Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
E1313_ARATH2.114e-3344.22Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis... [more]
E133_ARATH2.337e-3246.58Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E13F_HORVU2.957e-2744.76Putative glucan endo-1,3-beta-glucosidase GVI (Fra... [more]
E13A_ARATH5.043e-2745.45Glucan endo-1,3-beta-glucosidase, acidic isoform O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-424 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_E01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503936 ID=CF503936|Name=CF503936|organism=Citrus sinensis|type=EST|length=444bp
ACACTATGAGAGGGATTTTGCAGTTTCTTAAAGACCACGGCTCCCCTTTT
ACCATCAACCCGTACCCGTTTTTCGCTTATCAAAGTGACCCGAGACCCGA
GACTCTTGCCTTCTGTTTGTTTCAACCCAACGCGGGACGAGTTGACTCCG
GGACCGGGATCAAATACATGAACATGTTCGACGCCCAGGTTGATGCTGTA
CATTCAGCCTTGAATGCAATGGGGTTCAAGGATGTCGAGATTGTGGTTGC
AGAGACAGGGTGGCCTTACCGCGGAGACCCGAATGAGGTTGGACCTAGTG
TTGAGAATGCCAAGGCCTATAACGGGAACTTGATTGCTCACCTTAGATCA
ATGGCTGGAACTCCATTGATGCCTGGAAAATCTGTGGATACATATATTTT
TGCTCTCTATGATGAGGACTTGAAGCCTGGCCCTACCTCTGAAC
back to top