CF503937

Overview
NameCF503937
Unique NameCF503937
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length394
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF503937_ssr1 microsatellite CF503937_ssr1:1..14. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10777 contig Csv1_Contig10777:1..393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS193_ARATH (40S ribosomal protein S19-3 OS=Arabidopsis thaliana GN=RPS19C PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 7.344e-51
Identity = 91/105 (86.67%), Postives = 99/105 (94.29%), Query Frame = 1
Query:   79 MATARTVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            MAT +TVKDVSPHEFVKAY+AHLKRSGK+ELP WTDIVKT + KELAPYDPDWYY+RAASMARK+YLR GLGVG+FRRIYGGSKRNGSRPPHFCKSSG +ARHIL
Sbjct:    1 MATGKTVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHIL 105          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS191_ARATH (40S ribosomal protein S19-1 OS=Arabidopsis thaliana GN=RPS19A PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.636e-50
Identity = 90/105 (85.71%), Postives = 99/105 (94.29%), Query Frame = 1
Query:   79 MATARTVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            MAT +TVKDVSPH+FVKAY++HLKRSGK+ELP WTDIVKT + KELAPYDPDWYY+RAASMARK+YLR GLGVG+FRRIYGGSKRNGSRPPHFCKSSG IARHIL
Sbjct:    1 MATGKTVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHIL 105          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS192_ARATH (40S ribosomal protein S19-2 OS=Arabidopsis thaliana GN=RPS19B PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.137e-50
Identity = 91/105 (86.67%), Postives = 99/105 (94.29%), Query Frame = 1
Query:   79 MATARTVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            MAT +TVKDVSPH+FVKAY++HLKRSGK+ELP WTDIVKT + KELAPYDPDWYY+RAASMARKIYLR GLGVG+FRRIYGGSKRNGSRPPHFCKSSG IARHIL
Sbjct:    1 MATGKTVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKIYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHIL 105          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_ORYSJ (40S ribosomal protein S19 OS=Oryza sativa subsp. japonica GN=RPS19A PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 8.977e-49
Identity = 88/104 (84.62%), Postives = 98/104 (94.23%), Query Frame = 1
Query:   82 ATARTVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            +TARTVKDV+PHEFVKAYSAHLKRSGKMELP W DIVKTA+FKEL PYDPDWYY RAAS+ARKIYLRQG+GVG F++IYGG +RNGSRPPHFCKSSGAI+R+IL
Sbjct:    4 STARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNIL 107          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_MYAAR (40S ribosomal protein S19 OS=Mya arenaria GN=RPS19 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.662e-34
Identity = 59/100 (59.00%), Postives = 82/100 (82.00%), Query Frame = 1
Query:   94 TVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            +VKDVS HEF +A++A LK+SGKM++P WTD VKT  FKEL+PY+PDWY++RAAS+ R +Y+R   G+GSF +IYGG +R G+ P HFCK++G+I+R +L
Sbjct:    4 SVKDVSSHEFTRAFAAFLKKSGKMKVPEWTDFVKTGMFKELSPYEPDWYFIRAASICRHLYIRSPAGIGSFEKIYGGRRRRGTAPSHFCKANGSISRRLL 103          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_BRABE (40S ribosomal protein S19 OS=Branchiostoma belcheri GN=RPS19 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 4.189e-30
Identity = 59/100 (59.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:   94 TVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            TVKDV+  EFVKA++A LK+SGK++LP W D+VKTA  KELAPYDPDW+Y+RAAS AR +Y+R G+GVG+  +IYGG KR G++P  F   S  ++R +L
Sbjct:    6 TVKDVNQQEFVKAFAAFLKKSGKLKLPEWVDLVKTAPHKELAPYDPDWFYLRAASTARHLYMRGGVGVGAMCKIYGGRKRRGTKPAKFRVCSRGVSRTVL 105          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_RAT (40S ribosomal protein S19 OS=Rattus norvegicus GN=Rps19 PE=2 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 7.146e-30
Identity = 59/100 (59.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:   94 TVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            TVKDV+  EFV+A +A LK+SGK+++P W D VK A+ KELAPYD +W+Y RAAS AR +YLR G GVGS  +IYGG +RNG RP HF + S ++AR +L
Sbjct:    5 TVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVL 104          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_MOUSE (40S ribosomal protein S19 OS=Mus musculus GN=Rps19 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 7.146e-30
Identity = 59/100 (59.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:   94 TVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            TVKDV+  EFV+A +A LK+SGK+++P W D VK A+ KELAPYD +W+Y RAAS AR +YLR G GVGS  +IYGG +RNG RP HF + S ++AR +L
Sbjct:    5 TVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVL 104          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_AEQIR (40S ribosomal protein S19 OS=Aequipecten irradians GN=RPS19 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.079e-29
Identity = 54/100 (54.00%), Postives = 75/100 (75.00%), Query Frame = 1
Query:   94 TVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            +VKDV  H F KA +A LK+SGKM++P W  I+K ++F EL+PYD DW+Y RAAS+ R +Y+R   GVG+  +IYG  KRNG+ P H+C+SSG++AR +L
Sbjct:    4 SVKDVDSHTFTKALAAFLKKSGKMKIPEWATIIKLSKFNELSPYDEDWFYTRAASICRHLYIRSPAGVGALTKIYGDRKRNGTVPSHYCRSSGSVARRVL 103          
BLAST of CF503937 vs. ExPASy Swiss-Prot
Match: RS19_PONAB (40S ribosomal protein S19 OS=Pongo abelii GN=RPS19 PE=2 SV=3)

HSP 1 Score: 126.716 bits (317), Expect = 3.546e-29
Identity = 58/100 (58.00%), Postives = 75/100 (75.00%), Query Frame = 1
Query:   94 TVKDVSPHEFVKAYSAHLKRSGKMELPPWTDIVKTAQFKELAPYDPDWYYVRAASMARKIYLRQGLGVGSFRRIYGGSKRNGSRPPHFCKSSGAIARHIL 393
            TVKDV+  EFV+A +A LK+SGK+++P W D VK A+ KELAPYD +W+Y RAAS AR +YLR G GVGS  +IYGG +RNG  P HF + S ++AR +L
Sbjct:    5 TVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVL 104          
The following BLAST results are available for this feature:
BLAST of CF503937 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
RS193_ARATH7.344e-5186.6740S ribosomal protein S19-3 OS=Arabidopsis thalian... [more]
RS191_ARATH1.636e-5085.7140S ribosomal protein S19-1 OS=Arabidopsis thalian... [more]
RS192_ARATH2.137e-5086.6740S ribosomal protein S19-2 OS=Arabidopsis thalian... [more]
RS19_ORYSJ8.977e-4984.6240S ribosomal protein S19 OS=Oryza sativa subsp. j... [more]
RS19_MYAAR3.662e-3459.0040S ribosomal protein S19 OS=Mya arenaria GN=RPS19... [more]
RS19_BRABE4.189e-3059.0040S ribosomal protein S19 OS=Branchiostoma belcher... [more]
RS19_RAT7.146e-3059.0040S ribosomal protein S19 OS=Rattus norvegicus GN=... [more]
RS19_MOUSE7.146e-3059.0040S ribosomal protein S19 OS=Mus musculus GN=Rps19... [more]
RS19_AEQIR2.079e-2954.0040S ribosomal protein S19 OS=Aequipecten irradians... [more]
RS19_PONAB3.546e-2958.0040S ribosomal protein S19 OS=Pongo abelii GN=RPS19... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-425 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_E02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503937 ID=CF503937|Name=CF503937|organism=Citrus sinensis|type=EST|length=394bp
GAGAGAGAGAGAGAGCGCAATTCCACCACCTTCTTGCAAAAGCGAAGCTT
TGAGTCGCTCTCCTGCTCTGTTGTGACCATGGCTACAGCTAGGACTGTCA
AGGACGTGTCTCCTCATGAGTTCGTGAAGGCTTACTCTGCTCATCTCAAG
CGATCTGGCAAGATGGAACTTCCCCCATGGACTGACATAGTCAAGACTGC
TCAGTTCAAGGAGCTTGCTCCCTACGACCCTGACTGGTACTATGTCAGAG
CTGCCTCCATGGCAAGGAAAATCTACTTGAGGCAAGGGCTTGGTGTGGGT
TCTTTCAGGAGGATTTATGGTGGAAGTAAGAGGAATGGAAGCCGTCCACC
TCACTTCTGCAAAAGCAGTGGTGCTATTGCTCGCCACATTCTTC
back to top