CF503951

Overview
NameCF503951
Unique NameCF503951
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length635
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11640 contig Csv1_Contig11640:142..777. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503951 vs. ExPASy Swiss-Prot
Match: TT12_ARATH (Protein TRANSPARENT TESTA 12 OS=Arabidopsis thaliana GN=TT12 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.399e-19
Identity = 51/149 (34.23%), Postives = 85/149 (57.05%), Query Frame = 2
Query:  128 LKGRVWKESKKLWRVAFPAMLARVSQYGMFVITQGFIGHLGEVELAAYALIQIIAVRFSNGILIGMSSATETLCGQAFGAKQYHMMGIYLQRSWIINLATGTILLPAFIFAADIFKLLGEQTDIANRAGDISLWFIGILYFFVFSLTIQ 574
            LK  VW ESK LW ++  +++  V  Y +  +T  F GHLG ++LA  ++  +     + GI++GM+SA +T+CGQA+GA+QY  MGI  QR+ +++LA    L   + ++  I K +G+   IA+     +   I  +Y F  +  +Q
Sbjct:   45 LKLAVW-ESKLLWTLSGASIVVSVLNYMLSFVTVMFTGHLGSLQLAGASIATVGIQGLAYGIMLGMASAVQTVCGQAYGARQYSSMGIICQRAMVLHLAAAVFLTFLYWYSGPILKTMGQSVAIAHEGQIFARGMIPQIYAFALACPMQ 192          
The following BLAST results are available for this feature:
BLAST of CF503951 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TT12_ARATH2.399e-1934.23Protein TRANSPARENT TESTA 12 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-439 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_F05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503951 ID=CF503951|Name=CF503951|organism=Citrus sinensis|type=EST|length=635bp
AATTAATCTCTTGGGCTGAAACCCTAGCTAGAAGCTATCCTCCTTGTTCA
ACTAATCAAGCAAGAACTTCTCTCAAGGCCAAATGGAGGAGAGACTCCTC
GGTTCAGAAGCGAAAGATATTGATGATTTAAAAGGGAGGGTTTGGAAAGA
ATCGAAAAAGCTATGGAGGGTTGCATTTCCCGCAATGTTAGCTAGGGTTT
CTCAGTATGGTATGTTTGTTATCACACAAGGATTTATTGGTCATCTTGGC
GAGGTTGAGCTTGCAGCTTACGCGCTCATTCAAATCATAGCCGTCCGATT
TTCAAATGGGATTTTGATCGGCATGTCAAGCGCAACTGAAACTCTGTGCG
GGCAAGCATTTGGAGCAAAGCAATACCACATGATGGGTATCTACTTGCAA
AGATCATGGATCATAAATCTTGCTACTGGAACAATATTGCTTCCTGCGTT
TATCTTCGCAGCGGATATTTTCAAACTGCTCGGAGAACAAACAGACATAG
CAAACAGAGCCGGAGACATCTCACTTTGGTTCATTGGCATTCTCTATTTC
TTTGTCTTCAGCTTAACGATCCAAAGTACTTGCAAGCACAGCTCAAGAAC
ATGATCGTCGGATGGCTTTCGGCTGTGCATTTGCT
back to top