CF504033

Overview
NameCF504033
Unique NameCF504033
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length574
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA_PRUDU (Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.266e-91
Identity = 172/190 (90.53%), Postives = 173/190 (91.05%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA4_GOSHI (Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.266e-91
Identity = 172/190 (90.53%), Postives = 173/190 (91.05%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA2_GOSHI (Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.266e-91
Identity = 172/190 (90.53%), Postives = 173/190 (91.05%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA1_PEA (Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.266e-91
Identity = 172/190 (90.53%), Postives = 173/190 (91.05%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA3_HORVU (Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.621e-90
Identity = 171/190 (90.00%), Postives = 172/190 (90.53%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA2_ORYSJ (Tubulin alpha-2 chain OS=Oryza sativa subsp. japonica GN=TUBA PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.621e-90
Identity = 171/190 (90.00%), Postives = 172/190 (90.53%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA1_ELEIN (Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.621e-90
Identity = 171/190 (90.00%), Postives = 172/190 (90.53%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA2_MAIZE (Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 2.117e-90
Identity = 170/190 (89.47%), Postives = 172/190 (90.53%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA1_MAIZE (Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 2.117e-90
Identity = 170/190 (89.47%), Postives = 172/190 (90.53%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
BLAST of CF504033 vs. ExPASy Swiss-Prot
Match: TBA_DAUCA (Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 2.765e-90
Identity = 169/190 (88.95%), Postives = 173/190 (91.05%), Query Frame = 3
Query:    3 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSM 572
            KEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQ+STSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDIC+RSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSM
Sbjct:  112 KEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM 301          
The following BLAST results are available for this feature:
BLAST of CF504033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 419
Match NameE-valueIdentityDescription
TBA_PRUDU4.266e-9190.53Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 ... [more]
TBA4_GOSHI4.266e-9190.53Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA2_GOSHI4.266e-9190.53Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA1_PEA4.266e-9190.53Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE... [more]
TBA3_HORVU1.621e-9090.00Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 ... [more]
TBA2_ORYSJ1.621e-9090.00Tubulin alpha-2 chain OS=Oryza sativa subsp. japon... [more]
TBA1_ELEIN1.621e-9090.00Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 ... [more]
TBA2_MAIZE2.117e-9089.47Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV... [more]
TBA1_MAIZE2.117e-9089.47Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV... [more]
TBA_DAUCA2.765e-9088.95Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-521 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_E11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504033 ID=CF504033|Name=CF504033|organism=Citrus sinensis|type=EST|length=574bp
GGAAGGAGATTGTTGATCTATGCTTGGACCGGATCAGAAAACTTGCTGAT
AATTGCACTGGGCTACAAGGGTTCCTGGTTTTCAATGCTGTTGGAGGTGG
TACTGGCTCTGGACTTGGGTCACTTCTCTTGGAGCGTCTCTCTGTTGACT
ATGGAAAGAAATCAAAGCTTGGTTTCACTGTGTATCCTTCACCTCAGGTT
TCCACATCAGTTGTGGAACCTTACAACAGTGTTCTTTCAACACATTCCCT
CCTTGAGCACACCGATGTTGCTGTGCTTCTTGATAATGAAGCCATCTATG
ATATCTGCAGGCGCTCTCTTGACATTGAGCGCCCCACTTACACCAATCTC
AACCGACTTGTCTCTCAGGTGATCTCATCCCTCACTGCCTCTTTGAGGTT
TGATGGAGCTCTGAATGTGGATGTGACTGAGTTCCAGACCAATTTGGTTC
CCTATCCAAGGATCCATTTCATGCTCTCCTCTTATGCCCCAGTTATCTCT
GCAGAGAAGGCATTCCATGAGCAACTTTCAGTTGCTGAGATCACCAACAG
TGCTTTTGAGCCATCATCCATGAT
back to top