CF504037

Overview
NameCF504037
Unique NameCF504037
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length469
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3756 contig Csv1_Contig3756:354..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504037 vs. ExPASy Swiss-Prot
Match: Y5986_ARATH (Uncharacterized protein At5g39865 OS=Arabidopsis thaliana GN=At5g39865 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.135e-17
Identity = 41/95 (43.16%), Postives = 66/95 (69.47%), Query Frame = 1
Query:  193 EDRIVVYLTSLRGIRRTFEDCYAVRMIFRGFRVWVDERDVSMDSAYKKELQCVFGGK-----NVTLPQVFIRGKHVGNADVLKSMYETGELARVL 462
            ++R+V+Y TSLRGIR+T+EDC  +R+I +   + +DERDVSM S +K EL+ +  GK      +TLP+VF+  K++G  + +K + E GEL +++
Sbjct:  224 KERVVLYFTSLRGIRKTYEDCCNIRIILKSLGIRIDERDVSMHSGFKDELKKLLEGKFNNGVGITLPRVFLGNKYLGGVEEIKKLNENGELEKLI 318          
BLAST of CF504037 vs. ExPASy Swiss-Prot
Match: Y3885_ARATH (Uncharacterized protein At3g28850 OS=Arabidopsis thaliana GN=At3g28850 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.639e-16
Identity = 41/97 (42.27%), Postives = 67/97 (69.07%), Query Frame = 1
Query:  193 EDRIVVYLTSLRGIRRTFEDCYAVRMIFRGFRVWVDERDVSMDSAYKKELQCVFG-----GKNVTLPQVFIRGKHVGNADVLKSMYETGELARVLDG 468
            ++R+++Y TSLRGIR+T+E+   VR+I +   + VDERDVSM S +K EL+ + G     G  +TLP+VF+  K++G A+ ++ + E G+L ++L G
Sbjct:  250 KERVILYFTSLRGIRKTYEESCDVRVILKSLGIRVDERDVSMHSGFKDELKELLGEKFNKGVGITLPRVFLGRKYIGGAEEIRKLNEDGKLEKLLGG 346          
BLAST of CF504037 vs. ExPASy Swiss-Prot
Match: GRCR1_HUMAN (Glutaredoxin domain-containing cysteine-rich protein 1 OS=Homo sapiens GN=GRXCR1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.215e-13
Identity = 43/108 (39.81%), Postives = 68/108 (62.96%), Query Frame = 1
Query:  157 YNNESSI-RLPGTE---DRIVVYLTSLRGIRRTFEDCYAVRMIFRGFRVWVDERDVSMDSAYKKEL--QCVFGGKNVTLPQVFIRGKHVGNADVLKSMYETGELARVL 462
            +NN + + + P T+   DR+V+Y T LR +R TFE C  VR IF+  RV  +E++++++  Y KEL  +C    +  +LP VFI G ++G A+ + SM E+GEL  +L
Sbjct:  120 FNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDIL 227          
BLAST of CF504037 vs. ExPASy Swiss-Prot
Match: GRCR1_MOUSE (Glutaredoxin domain-containing cysteine-rich protein 1 OS=Mus musculus GN=Grxcr1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.099e-12
Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  196 DRIVVYLTSLRGIRRTFEDCYAVRMIFRGFRVWVDERDVSMDSAYKKEL--QCVFGGKNVTLPQVFIRGKHVGNADVLKSMYETGELARVL 462
            DR+V+Y T LR +R TFE C  VR IF+  RV  +E++++++  Y KEL  +C    +  +LP VFI G ++G A+ + SM E+GEL  +L
Sbjct:  137 DRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGDYGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDLL 227          
BLAST of CF504037 vs. ExPASy Swiss-Prot
Match: GRCR1_DROME (Glutaredoxin domain-containing cysteine-rich protein CG31559 OS=Drosophila melanogaster GN=CG31559 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 3.536e-11
Identity = 32/88 (36.36%), Postives = 55/88 (62.50%), Query Frame = 1
Query:  199 RIVVYLTSLRGIRRTFEDCYAVRMIFRGFRVWVDERDVSMDSAYKKELQCVFGGKNVTLPQVFIRGKHVGNADVLKSMYETGELARVL 462
            ++V+Y TS+  IR T+  C  V+ I R   V  +ERDV M   Y+ E++       V +PQ+++ G+H+G+A+ ++ M E+GEL ++L
Sbjct:  306 KVVLYTTSMGIIRETYTKCANVKQILRTLLVKFEERDVFMSVEYQAEMRQRMQSGQVRVPQLYVEGQHIGDAETVERMNESGELRQLL 393          
The following BLAST results are available for this feature:
BLAST of CF504037 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
Y5986_ARATH1.135e-1743.16Uncharacterized protein At5g39865 OS=Arabidopsis t... [more]
Y3885_ARATH1.639e-1642.27Uncharacterized protein At3g28850 OS=Arabidopsis t... [more]
GRCR1_HUMAN2.215e-1339.81Glutaredoxin domain-containing cysteine-rich prote... [more]
GRCR1_MOUSE1.099e-1242.86Glutaredoxin domain-containing cysteine-rich prote... [more]
GRCR1_DROME3.536e-1136.36Glutaredoxin domain-containing cysteine-rich prote... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-525 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_F06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504037 ID=CF504037|Name=CF504037|organism=Citrus sinensis|type=EST|length=469bp
TCTGCTAGCAATTCATTCAAAGGTAAGGTCAAGCAACTTCGTAATTTATT
TGAGCCCAAAAAATCATCCAAAAAAATTAATTTAAACGAACCCGAATCCC
CGCAACAGCACCACCTCATCAAGTTAACAAAACCCGTGAAATCTTTATCT
TTGTGTTATAATAATGAGTCTTCGATTAGATTACCGGGTACTGAGGATCG
AATTGTTGTTTATTTAACGAGTCTGAGAGGGATTCGAAGGACTTTTGAGG
ATTGTTATGCGGTTAGGATGATATTTAGAGGGTTTAGAGTTTGGGTTGAC
GAGAGAGATGTTTCGATGGATTCCGCGTATAAGAAAGAATTACAGTGTGT
ATTTGGTGGGAAGAATGTGACTTTGCCGCAGGTTTTTATCCGGGGAAAGC
ATGTGGGAAATGCTGATGTGTTGAAGAGTATGTATGAAACCGGTGAATTG
GCTAGGGTTCTTGATGGGT
back to top