CF504043

Overview
NameCF504043
Unique NameCF504043
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length524
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPK9_ARATH (Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.065e-31
Identity = 63/99 (63.64%), Postives = 82/99 (82.83%), Query Frame = 3
Query:  228 PAARQLHDAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            P      ++IL  A+EDVKL YTLG+ELGRG+FG+TYLCTENSTG ++ACKSI K+KLV    KDD+RRE+++MQ+LSGQPNIV+FK AYED++ V++V
Sbjct:   70 PKTTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAYEDEKAVNLV 168          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPKX_ARATH (Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 9.015e-31
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 3
Query:  228 PAARQLHDAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            PA      AIL K YEDVKL YTL +ELGRG+FG+TYLCTE STG  FACKSI K+KLV    K+D+RRE+++MQ+LSGQPNIV+FK AYED++ V++V
Sbjct:   52 PAKHSGAAAILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKGDKEDMRREIQIMQHLSGQPNIVEFKGAYEDEKAVNLV 150          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPKJ_ARATH (Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.439e-28
Identity = 59/95 (62.11%), Postives = 75/95 (78.95%), Query Frame = 3
Query:  240 QLHDAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            Q  + IL + +ED+K  Y+LGRELGRG+FGITY+CTE S+G  FACKSI KRKL+    ++DVRRE+++M YLSGQPNIV+ K AYED Q VH+V
Sbjct:   81 QQPEPILGRPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTKDREDVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLV 175          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPK2_MAIZE (Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.439e-28
Identity = 56/92 (60.87%), Postives = 76/92 (82.61%), Query Frame = 3
Query:  249 DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            D IL K YEDV+  Y+ G+ELGRG+FG+TYLCTE ++G ++ACKSI KRKLV+   ++D+RRE+++MQ+LSGQPNIV+F+ AYED   VH+V
Sbjct:   51 DTILGKQYEDVRSVYSFGKELGRGQFGVTYLCTEIASGRQYACKSISKRKLVSKADREDIRREIQIMQHLSGQPNIVEFRGAYEDKSNVHVV 142          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPK_DAUCA (Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 1.880e-28
Identity = 62/127 (48.82%), Postives = 85/127 (66.93%), Query Frame = 3
Query:  156 FSKGQDSDHPAARQLHDKGQDGDYPAARQLH----DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            + K      P A+      Q G     RQ+H    + IL K +ED++  YTLG+ELGRG+FG  Y CTENS+G  +ACKSI KRKLV+   K+D++RE++++Q+LSGQPNIV+FK  +ED Q VH+V
Sbjct:   32 YEKSSQRSQPQAQPQPQVQQTGPSLKPRQVHRPESNTILGKPFEDIRGKYTLGKELGRGQFGCVYQCTENSSGQLYACKSILKRKLVSKNDKEDIKREIQILQHLSGQPNIVEFKGVFEDRQSVHLV 158          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPKL_ARATH (Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.455e-28
Identity = 59/115 (51.30%), Postives = 82/115 (71.30%), Query Frame = 3
Query:  183 PAARQLHDK-GQDGDYPAARQLHDAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            P  + +H +       P + +  D IL K +ED++  Y+LG+ELGRG+FGITY+C E  TG  +ACKSI KRKL++   K+DV+RE+++MQYLSGQPNIV+ K AYED Q +H+V
Sbjct:   43 PMTQPIHQQISTPSSNPVSVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKGAYEDRQSIHLV 157          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPK2_ORYSJ (Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 4.188e-28
Identity = 56/92 (60.87%), Postives = 76/92 (82.61%), Query Frame = 3
Query:  249 DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            D IL K Y+DV+  Y+LG+ELGRG+FG+TYLCTE ++G ++ACKSI KRKLV+   K+D+RRE+++MQ+LSGQ NIV+F+ AYED   VH+V
Sbjct:   71 DTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQQNIVEFRGAYEDKSNVHVV 162          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPKY_ARATH (Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.591e-27
Identity = 56/90 (62.22%), Postives = 73/90 (81.11%), Query Frame = 3
Query:  255 ILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            +L +  EDVK  YTLG+ELGRG+FG+T+LCT+ +TGL+FACK+I KRKLVN    +DVRREV++M +L+GQPNIV+ K AYED   VH+V
Sbjct:   56 VLGRPMEDVKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLV 145          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPKF_ARATH (Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.898e-27
Identity = 56/92 (60.87%), Postives = 71/92 (77.17%), Query Frame = 3
Query:  249 DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            + IL K +E+++  YTLG+ELGRG+FGITY C ENSTG  +ACKSI KRKL      DDV+RE+++MQYLSGQ NIV+ K AYED Q +H+V
Sbjct:   88 ETILGKPFEEIRKLYTLGKELGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDIDDVKREIQIMQYLSGQENIVEIKGAYEDRQSIHLV 179          
BLAST of CF504043 vs. ExPASy Swiss-Prot
Match: CDPKH_ARATH (Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.298e-26
Identity = 54/90 (60.00%), Postives = 72/90 (80.00%), Query Frame = 3
Query:  255 ILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDVRREVEVMQYLSGQPNIVQFKAAYEDDQFVHIV 524
            +L +  EDVK  Y+LG+ELGRG+FG+T+LCT+ +TG +FACK+I KRKLVN    +DVRREV++M +L+GQPNIV+ K AYED   VH+V
Sbjct:   61 VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLV 150          
The following BLAST results are available for this feature:
BLAST of CF504043 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
CDPK9_ARATH1.065e-3163.64Calcium-dependent protein kinase 9 OS=Arabidopsis ... [more]
CDPKX_ARATH9.015e-3164.65Calcium-dependent protein kinase 33 OS=Arabidopsis... [more]
CDPKJ_ARATH1.439e-2862.11Calcium-dependent protein kinase 19 OS=Arabidopsis... [more]
CDPK2_MAIZE1.439e-2860.87Calcium-dependent protein kinase 2 OS=Zea mays GN=... [more]
CDPK_DAUCA1.880e-2848.82Calcium-dependent protein kinase OS=Daucus carota ... [more]
CDPKL_ARATH2.455e-2851.30Calcium-dependent protein kinase 21 OS=Arabidopsis... [more]
CDPK2_ORYSJ4.188e-2860.87Calcium-dependent protein kinase isoform 2 OS=Oryz... [more]
CDPKY_ARATH1.591e-2762.22Calcium-dependent protein kinase 34 OS=Arabidopsis... [more]
CDPKF_ARATH7.898e-2760.87Calcium-dependent protein kinase 15 OS=Arabidopsis... [more]
CDPKH_ARATH2.298e-2660.00Calcium-dependent protein kinase 17 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-531 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_G02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504043 ID=CF504043|Name=CF504043|organism=Citrus sinensis|type=EST|length=524bp
ATTTTAAAGAATCAATTCAAAGGCAGGAACTGTGATGTGTAGTTGAATAC
ATCTGGGTCCTGCATATTCTTTGAAATTGCCCACCTGCAAAAGTCAAATC
CTGAGGTCCTGTCTCGCATCCTCTGTGCCGGTGGCGGCCAGAAATGGGTT
GCATTTTCAGCAAAGGCCAAGACTCAGACCACCCAGCAGCACGCCAACTC
CATGACAAAGGCCAAGATGGAGACTACCCAGCAGCACGCCAACTCCATGA
TGCAATTCTTTGTAAAGCTTATGAGGATGTTAAGTTACATTATACTCTTG
GTAGAGAATTGGGTAGGGGTGAATTTGGTATAACCTATCTTTGTACTGAG
AATTCAACCGGTTTGGAATTTGCTTGCAAGTCTATTCCTAAAAGAAAGCT
GGTAAATGATTATTATAAGGATGATGTAAGAAGAGAGGTTGAGGTAATGC
AATATTTGAGTGGGCAGCCCAACATAGTCCAATTCAAGGCTGCTTATGAG
GATGACCAATTTGTGCATATTGTT
back to top