CF504044

Overview
NameCF504044
Unique NameCF504044
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length378
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6249 contig Csv1_Contig6249:56..432. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_MEDSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 8.000e-53
Identity = 95/120 (79.17%), Postives = 107/120 (89.17%), Query Frame = 1
Query:    4 SMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            ++ISSA V T NRAS AQA++VAPFTGLKSS+ FP TKKTNNDITSIASNGGRV CM+VWPP G KKFETLSYLPPL++E L KE+ YLIR GWIPCLEFELEKG+VYRE+H+SPGYYDG
Sbjct:    2 ALISSAAVTTVNRASSAQANLVAPFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDG 121          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.509e-51
Identity = 96/121 (79.34%), Postives = 111/121 (91.74%), Query Frame = 1
Query:    1 SSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SSMISSATVAT +RA+ AQA+MVAPFTGLKS++AFPAT+K+NNDITS+ASNGGRVQCMKVWPP GL+KFETLSYLPPLS E+L K+I YLI  GWIPCLEFELE  +VYRE+++SPGYYDG
Sbjct:    3 SSMISSATVATVSRATPAQATMVAPFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDG 123          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 7.488e-51
Identity = 96/120 (80.00%), Postives = 107/120 (89.17%), Query Frame = 1
Query:    4 SMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SMISSATVA  +RAS AQ+SMVAPFT LKS+SAFP T+KTNNDITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E L KE++YL+R   IPCLEFELE G+VYREH++SPGYYDG
Sbjct:    4 SMISSATVAAVSRASPAQSSMVAPFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDG 123          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.845e-50
Identity = 91/118 (77.12%), Postives = 102/118 (86.44%), Query Frame = 1
Query:   10 ISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            ISS+ +AT NR +  QAS+ APFTGLKS+ AFP TKK NND +S+ SNGGRVQCMKVWPP GLKK+ETLSYLPPLSDEAL KEI+YLIR+ WIPCLEFELE G+VYREHH SPGYYDG
Sbjct:    4 ISSSAIATVNRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDG 121          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_HEVBR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hevea brasiliensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.279e-50
Identity = 92/121 (76.03%), Postives = 104/121 (85.95%), Query Frame = 1
Query:    1 SSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SSM+S+A VA  NRAS AQASMVAPFTGLKS+SAFP T+KT  DITSIASNGGRVQCM+VWPP G K +ETLSYLPPL+ E L KE+ YL+R GW+PCLEFELE G VYRE+H+SPGYYDG
Sbjct:    3 SSMLSTAAVACINRASPAQASMVAPFTGLKSTSAFPTTRKTTTDITSIASNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPCLEFELEHGTVYREYHRSPGYYDG 123          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 3.146e-49
Identity = 95/123 (77.24%), Postives = 108/123 (87.80%), Query Frame = 1
Query:    1 SSMISSATVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SSMISS TVAT  A+R + AQA MVAPF GLKSSSAFP T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE++YL+R  W+PCLEFELE G+VYRE+H+SPGYYDG
Sbjct:    3 SSMISSGTVATVSADRPAPAQARMVAPFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDG 124          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_MANES (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Manihot esculenta PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 7.008e-49
Identity = 90/121 (74.38%), Postives = 103/121 (85.12%), Query Frame = 1
Query:    1 SSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SSM+S+ATVA+ NR S AQA+MVAPFTGLKS+  FP T+KTN+DITSI SNGG+VQCMKVWP  G+KKFETLSYLPPL+ E L  E+ YL+RSGWIPCLEFELE G VYREH + PGYYDG
Sbjct:    3 SSMLSTATVASINRVSPAQATMVAPFTGLKSTPVFPTTRKTNSDITSITSNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRSGWIPCLEFELEHGLVYREHARVPGYYDG 123          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 9.153e-49
Identity = 95/123 (77.24%), Postives = 108/123 (87.80%), Query Frame = 1
Query:    1 SSMISSATVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SSMISS TVAT  A+R + AQA MVAPFTGLKSSSA P T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE++YL+R  W+PCLEFELE G+VYRE+H+SPGYYDG
Sbjct:    3 SSMISSGTVATVSADRPAPAQARMVAPFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDG 124          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.933e-48
Identity = 89/122 (72.95%), Postives = 109/122 (89.34%), Query Frame = 1
Query:    1 SSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNN-DITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SS++SSA VAT  R+++AQASMVAPFTGLKS+++FP TKK NN DITS+ASNGGRV+CM+VWPP  +KK+ETLSYLP LSDE LLKE+ YL+++GW+PCLEFE E G+VYRE+HKSPGYYDG
Sbjct:    3 SSIVSSAAVAT--RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDG 122          
BLAST of CF504044 vs. ExPASy Swiss-Prot
Match: RBS0_SOLTU (Ribulose bisphosphate carboxylase small chain C, chloroplastic OS=Solanum tuberosum GN=RBCS-C PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.254e-47
Identity = 88/122 (72.13%), Postives = 108/122 (88.52%), Query Frame = 1
Query:    1 SSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNN-DITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDG 363
            SS++SSA VAT  R+++AQASMVAPFTGLKS+++FP TKK NN DITS+ASNGGRV+CM+VWPP  +KK+ETLSYLP LSDE LLKE+ YL+++GW+PCLEFE E G+VYREH+ SPGYYDG
Sbjct:    3 SSIVSSAAVAT--RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYREHNSSPGYYDG 122          
The following BLAST results are available for this feature:
BLAST of CF504044 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RBS_MEDSA8.000e-5379.17Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_FAGCR1.509e-5179.34Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE7.488e-5180.00Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_LACSA2.845e-5077.12Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HEVBR8.279e-5076.03Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PYRPY3.146e-4977.24Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MANES7.008e-4974.38Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP9.153e-4977.24Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3_SOLTU5.933e-4872.95Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS0_SOLTU2.254e-4772.13Ribulose bisphosphate carboxylase small chain C, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-532 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_G03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504044 ID=CF504044|Name=CF504044|organism=Citrus sinensis|type=EST|length=378bp
TCCTCAATGATCTCATCGGCCACCGTTGCCACCGCGAACCGCGCCAGCCT
TGCTCAGGCCAGCATGGTCGCCCCCTTCACCGGCCTCAAGTCTTCTTCTG
CTTTCCCAGCAACCAAGAAGACCAACAATGACATTACTTCCATTGCAAGC
AACGGCGGAAGAGTCCAATGCATGAAGGTGTGGCCACCAACTGGCTTGAA
GAAGTTCGAGACTCTCTCATACCTCCCGCCACTGTCCGATGAAGCTTTGC
TCAAGGAAATCAATTACCTTATCCGCTCCGGCTGGATTCCCTGCTTGGAA
TTCGAGTTGGAGAAAGGATGGGTGTACCGTGAGCACCACAAGTCACCAGG
ATACTACGATGGGACGCTACTGGACAAT
back to top