CF504050

Overview
NameCF504050
Unique NameCF504050
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length574
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: GSTZ_EUPES (Glutathione S-transferase zeta class OS=Euphorbia esula PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.133e-59
Identity = 112/148 (75.68%), Postives = 130/148 (87.84%), Query Frame = 3
Query:   99 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            LKLYSY+RSSCS RVRI LNLKGL+YEY  VNL+KGEQF+P+FLKINPIGYVPALVDG+ V+SDSFAILMYLEEKYP+ P+LP+D+ +KAINYQAANIVSSSIQPLQNLAV+ +I EK   DE+  W + HI KGFAALEKLL+ +AG
Sbjct:   12 LKLYSYFRSSCSFRVRIALNLKGLDYEYVPVNLLKGEQFTPEFLKINPIGYVPALVDGEDVISDSFAILMYLEEKYPEHPILPADIHKKAINYQAANIVSSSIQPLQNLAVLNFIGEKVSPDEKVPWVQRHISKGFAALEKLLQGHAG 159          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: GSTZ1_DIACA (Glutathione S-transferase 1 OS=Dianthus caryophyllus GN=GST1 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.872e-54
Identity = 100/148 (67.57%), Postives = 128/148 (86.49%), Query Frame = 3
Query:   99 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            ++LYS+  SSC+ RVRI L+LKGL++EYKAV+L KGE  +P+FLK+NP+GYVP LV GD V++DS AI+MYLEEK+P+ PLLP DL+++A+NYQAANIV+S+IQPLQNLAV+ YIEEK G+DE+  WAK HI KGF+ALEKLLK +AG
Sbjct:    9 MQLYSFSLSSCAWRVRIALHLKGLDFEYKAVDLFKGEHLTPEFLKLNPLGYVPVLVHGDIVIADSLAIIMYLEEKFPENPLLPQDLQKRALNYQAANIVTSNIQPLQNLAVLNYIEEKLGSDEKLSWAKHHIKKGFSALEKLLKGHAG 156          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: GSTZ1_ARATH (Glutathione S-transferase zeta-class 1 OS=Arabidopsis thaliana GN=GST18 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.193e-54
Identity = 101/148 (68.24%), Postives = 120/148 (81.08%), Query Frame = 3
Query:   99 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            LKLYSYWRSSC+HRVRI L LKGL+YEY  VNL+KG+QF  DF KINP+G VPALVDGD V++DSFAI+MYL+EKYP+PPLLP DL ++A+NYQA +IV S IQP QNLAV++YIEEK   +E+  W    I KGF ALEKLL + AG
Sbjct:    9 LKLYSYWRSSCAHRVRIALALKGLDYEYIPVNLLKGDQFDSDFKKINPMGTVPALVDGDVVINDSFAIIMYLDEKYPEPPLLPRDLHKRAVNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVNCAG 156          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: GSTZ2_ARATH (Probable glutathione S-transferase zeta-class 2 OS=Arabidopsis thaliana GN=At2g02380 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 6.657e-52
Identity = 96/148 (64.86%), Postives = 118/148 (79.73%), Query Frame = 3
Query:   99 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            LKLYSYWRSSC+HRVRI L LKGL+YEY  VNL+KG+Q   DF KINP+G VPALVDGD V++DSFAI+MYL++KYP+PPLLPSD  ++A+NYQA +IV S IQP QN+A+ +Y+E+K  A+E+  W    I KGF ALEKLL   AG
Sbjct:   12 LKLYSYWRSSCAHRVRIALTLKGLDYEYIPVNLLKGDQSDSDFKKINPMGTVPALVDGDVVINDSFAIIMYLDDKYPEPPLLPSDYHKRAVNYQATSIVMSGIQPHQNMALFRYLEDKINAEEKTAWITNAITKGFTALEKLLVSCAG 159          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: GSTZ2_DIACA (Glutathione S-transferase 2 (Fragment) OS=Dianthus caryophyllus GN=GST2 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.063e-49
Identity = 91/137 (66.42%), Postives = 118/137 (86.13%), Query Frame = 3
Query:   99 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFA 509
            ++LYSY  SSC+ RVRI L+LKGL++EYKAV+L+KGE  +P+FLK+NP+GYVPALV GD V++DS AI+MYLEEK+P+ PLLP DL+++A+NYQAANIV+S+IQP QNLAV+ YIEEK G+DE+  WA  HI KGF+
Sbjct:    9 MQLYSYSSSSCAWRVRIALHLKGLDFEYKAVDLLKGEHLTPEFLKLNPLGYVPALVHGDIVIADSLAIIMYLEEKFPENPLLPRDLQKRALNYQAANIVASNIQPFQNLAVLNYIEEKLGSDEKLSWANHHIKKGFS 145          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: GSTZ_WHEAT (Glutathione S-transferase OS=Triticum aestivum GN=GSTZ1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.476e-40
Identity = 84/141 (59.57%), Postives = 102/141 (72.34%), Query Frame = 3
Query:  105 LYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLL 527
            LY  W SSCSHRVRI LNLKG++YEYKAVN     +  PD+ KINPI Y+PALVDGDFV+SDS AI++YLE+KYPQ PL+P D+K K ++ Q ANIV SSIQPLQ   V+   E +   DE     + +I KGF A+EKLL
Sbjct:    8 LYGAWISSCSHRVRIALNLKGVDYEYKAVN----PRTDPDYEKINPIKYIPALVDGDFVLSDSLAIMLYLEDKYPQHPLVPKDIKTKGLDLQIANIVCSSIQPLQGYGVIGLHEGRLSPDESLEVVQRYIDKGFRAIEKLL 144          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: MAAI_DICDI (Maleylacetoacetate isomerase OS=Dictyostelium discoideum GN=mai PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 6.478e-31
Identity = 71/153 (46.41%), Postives = 99/153 (64.71%), Query Frame = 3
Query:   93 NMLKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVK--GEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGAD-ERDIWAKTHIGKGFAALEKLLKDYAG 542
            N   LYSYWRSSCS RVR+ L  K ++YEYKA++L+K  G+Q S ++ K+NP+  +P L     ++  S AIL YLEE +P+ PL+P     +AI  Q   I+ S IQPLQNL V+  I + +G D ++  WA+T I  GF  LEKLL+ ++G
Sbjct:    4 NKTVLYSYWRSSCSWRVRVALAYKKIKYEYKAIHLLKDGGQQKSDEYSKLNPMKAIPTLEIDGHIIGQSLAILEYLEETHPENPLMPKGSYERAIARQMMQIIGSDIQPLQNLKVLGLIAQYSGDDSKKSEWARTVITNGFNGLEKLLEKHSG 156          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: MAAI_MOUSE (Maleylacetoacetate isomerase OS=Mus musculus GN=Gstz1 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.555e-29
Identity = 70/148 (47.30%), Postives = 98/148 (66.22%), Query Frame = 3
Query:  105 LYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVK--GEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            LYSY+RSSCS RVRI L LKG++YE   +NL+K  G+QF+ +F  +NP+  VPAL      +  S AI+ YLEE  P P LLP D +++AI    +++++S IQPLQNL+V+K +    G + +  WA+  I  GF ALEK+L+  AG
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQV----GQENQMQWAQKVITSGFNALEKILQSTAG 151          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: MAAI2_DROME (Probable maleylacetoacetate isomerase 2 OS=Drosophila melanogaster GN=CG9363 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.930e-28
Identity = 69/149 (46.31%), Postives = 99/149 (66.44%), Query Frame = 3
Query:  105 LYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVK--GEQFSPDFLKINPIGYVPAL-VDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            LYSYWRSSCS RVRI +NLK + Y+ K ++L+K  GEQ   ++ ++NP+  VPAL +DG  ++ +S AI+ YLEE  PQ PLLP D+ ++A   +   I+ S IQPLQNL V+ ++    G +++  WA+  I +GF A+EK L   AG
Sbjct:   18 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLI-ESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHV----GEEKKKEWAQHWITRGFRAVEKALSTSAG 161          
BLAST of CF504050 vs. ExPASy Swiss-Prot
Match: MAAI_HUMAN (Maleylacetoacetate isomerase OS=Homo sapiens GN=GSTZ1 PE=1 SV=3)

HSP 1 Score: 123.635 bits (309), Expect = 6.704e-28
Identity = 68/148 (45.95%), Postives = 95/148 (64.19%), Query Frame = 3
Query:  105 LYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVK--GEQFSPDFLKINPIGYVPALVDGDFVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHIGKGFAALEKLLKDYAG 542
            LYSY+RSSCS RVRI L LKG++Y+   +NL+K  G+QFS DF  +NP+  VP L      +  S AI+ YLEE  P P LLP D K++A     +++++  IQPLQNL+V+K +    G + +  WA+  I  GF ALE++L+  AG
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQV----GEEMQLTWAQNAITCGFNALEQILQSTAG 151          
The following BLAST results are available for this feature:
BLAST of CF504050 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
GSTZ_EUPES1.133e-5975.68Glutathione S-transferase zeta class OS=Euphorbia ... [more]
GSTZ1_DIACA1.872e-5467.57Glutathione S-transferase 1 OS=Dianthus caryophyll... [more]
GSTZ1_ARATH3.193e-5468.24Glutathione S-transferase zeta-class 1 OS=Arabidop... [more]
GSTZ2_ARATH6.657e-5264.86Probable glutathione S-transferase zeta-class 2 OS... [more]
GSTZ2_DIACA1.063e-4966.42Glutathione S-transferase 2 (Fragment) OS=Dianthus... [more]
GSTZ_WHEAT4.476e-4059.57Glutathione S-transferase OS=Triticum aestivum GN=... [more]
MAAI_DICDI6.478e-3146.41Maleylacetoacetate isomerase OS=Dictyostelium disc... [more]
MAAI_MOUSE3.555e-2947.30Maleylacetoacetate isomerase OS=Mus musculus GN=Gs... [more]
MAAI2_DROME3.930e-2846.31Probable maleylacetoacetate isomerase 2 OS=Drosoph... [more]
MAAI_HUMAN6.704e-2845.95Maleylacetoacetate isomerase OS=Homo sapiens GN=GS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-538 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504050 ID=CF504050|Name=CF504050|organism=Citrus sinensis|type=EST|length=574bp
CTTTGCTGATTATAAGAAGGCAGAAGTGTTAGGTCAGTCTCTTCAATCTG
CAGTGCTTGTGTAGTCTGGTCAGAGACAGAACCTGTTGATAAAACATGCT
GAAACTGTATTCATACTGGAGGAGTTCATGCTCACATCGTGTCAGAATTG
GTCTCAACTTGAAAGGGTTAGAATATGAGTACAAAGCAGTTAACTTGGTG
AAAGGAGAGCAATTCAGTCCTGATTTTTTGAAGATCAACCCTATTGGCTA
TGTGCCGGCTTTGGTTGATGGAGATTTTGTTGTATCTGATTCTTTTGCCA
TTTTAATGTACCTGGAAGAGAAGTATCCTCAGCCTCCATTGTTGCCTTCT
GATCTTAAGAGAAAAGCTATCAATTATCAGGCTGCAAATATTGTTTCCTC
GAGCATACAGCCTCTTCAGAATCTTGCAGTAGTGAAGTACATTGAGGAAA
AAGCTGGTGCAGATGAGAGAGATATCTGGGCTAAAACTCACATTGGAAAA
GGCTTTGCGGCACTTGAGAAGCTGCTAAAAGACTATGCTGGGAATATGCA
ACTGGAGATGAAGTTTCCTGGCAG
back to top