CF504129

Overview
NameCF504129
Unique NameCF504129
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:92..517. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504129 vs. ExPASy Swiss-Prot
Match: PTI1_SOLLC (Pto-interacting protein 1 OS=Solanum lycopersicum GN=PTI1 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 6.860e-28
Identity = 55/89 (61.80%), Postives = 72/89 (80.90%), Query Frame = 3
Query:  159 MSCFGCCEEDDMHKAADNGNAYMVKSSAGTDGAYHASEAAPKGAQAVKVQPIEVPAISVDELKEITENFGTNALIGEGSYGRVYYGILK 425
            MSCF CC++DDMH+A DNG  +M  +SAG +G   A+E+A +  Q V +QPI VP+I+VDELK+IT+NFG+ ALIGEGSYGRVY+G+LK
Sbjct:    1 MSCFSCCDDDDMHRATDNG-PFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLK 88          
BLAST of CF504129 vs. ExPASy Swiss-Prot
Match: Y2706_ARATH (Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana GN=At2g47060 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.339e-23
Identity = 56/92 (60.87%), Postives = 65/92 (70.65%), Query Frame = 3
Query:  159 MSCFGCC-EEDDMHKAADNGNAYMVKSS--AGTDGAYH-ASEAAPKGAQAVKVQPIEVPAISVDELKEITENFGTNALIGEGSYGRVYYGIL 422
            MSCFGCC E+DDMHK AD G  +        G D  +H ASE A KG   VK+QPIEVP I   ELKE T++FG+N+LIGEGSYGRVYYG+L
Sbjct:    1 MSCFGCCGEDDDMHKTADYGGRHNQAKHFPPGNDARHHQASETAQKGPPVVKLQPIEVPIIPFSELKEATDDFGSNSLIGEGSYGRVYYGVL 92          
The following BLAST results are available for this feature:
BLAST of CF504129 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PTI1_SOLLC6.860e-2861.80Pto-interacting protein 1 OS=Solanum lycopersicum ... [more]
Y2706_ARATH1.339e-2360.87Probable receptor-like protein kinase At2g47060 OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-617 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_B09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504129 ID=CF504129|Name=CF504129|organism=Citrus sinensis|type=EST|length=427bp
CGCTTTATACGTTTTTCTTCATCCTGCGCACCTATCGTCGTCTTATCCTG
CGCACCTCACGCCGGCTCCAGAGTGATTCATTCAAAATATCCAGCCTCGT
TGCTTTTCTCTATATCTCAGCTAGCTTTCATAGAGGGGCATTATTGTGGC
AGTGAATCATGAGCTGCTTCGGCTGTTGTGAAGAAGATGATATGCATAAA
GCTGCTGACAATGGCAATGCATACATGGTTAAAAGTTCAGCAGGAACTGA
TGGAGCCTATCATGCATCTGAAGCAGCACCTAAGGGTGCTCAAGCTGTGA
AAGTCCAGCCCATTGAAGTCCCAGCAATTTCAGTGGATGAATTGAAGGAA
ATTACTGAGAACTTTGGGACTAATGCTTTGATTGGAGAAGGGTCATATGG
AAGAGTATATTATGGGATTCTTAAAAG
back to top