CF504130

Overview
NameCF504130
Unique NameCF504130
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length472
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig521 contig Csv1_Contig521:1..472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: RH28_ORYSJ (DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 2.676e-51
Identity = 102/145 (70.34%), Postives = 124/145 (85.52%), Query Frame = 3
Query:    6 SYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKI 440
            +Y+HRVGRTARAGREGYAVTFVTD+DRSLLKAIAK+AGS+LKSRIVAE+ + + +K+IE++EDQ++ I+Q      ILRKAEMEATKAENMIAHK+EI++RPKRTWF TEKEKKL  KA K S  +GK S + V SAQQAEDL++
Sbjct:  522 TYLHRVGRTARAGREGYAVTFVTDDDRSLLKAIAKKAGSQLKSRIVAEKPVAECAKLIEELEDQISTIIQEEREERILRKAEMEATKAENMIAHKDEIYSRPKRTWFATEKEKKLLAKAAKESTSQGK-SNSGVISAQQAEDLRL 665          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: RH28_ARATH (DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.124e-49
Identity = 97/145 (66.90%), Postives = 118/145 (81.38%), Query Frame = 3
Query:    6 SYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKI 440
            SYVHRVGRTARAGREGYAVTFVTD+DRSLLK IAK+ GSKLKSR++ EQSI KWS+II++MEDQ +A++        LRKAEME  KAENM+ H++EI+ARPKRTWF+TEKEKKL  +A+K S   G  +G E+ SA +AEDLK+
Sbjct:  495 SYVHRVGRTARAGREGYAVTFVTDSDRSLLKVIAKKVGSKLKSRVIPEQSIVKWSQIIDEMEDQYSAVISAERDERALRKAEMEFAKAENMLEHRDEIYARPKRTWFMTEKEKKLVAQAEKDS--AGNPAGGELVSADRAEDLKM 637          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_MAGGR (ATP-dependent RNA helicase DRS1 OS=Magnaporthe grisea GN=DRS1 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.747e-26
Identity = 58/126 (46.03%), Postives = 84/126 (66.67%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA---GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASI 377
            YVHRVGRTARAGR G A+T   + DR ++KA  K     G+K+ SRI+       W   I+++ED+V A+++      +L +A+ME  K ENMI ++++I ARPKRTWF TEK+KK A +A +A++
Sbjct:  584 YVHRVGRTARAGRSGTAITLAAEPDRKVVKAAVKAGKAQGAKISSRIIDAADADSWQAKIDELEDEVEAVMREEKEEKVLAQADMEMRKGENMIRYEDDIKARPKRTWFETEKDKKAAREAGRAAL 709          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_CHAGB (ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum GN=DRS1 PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.132e-25
Identity = 61/139 (43.88%), Postives = 85/139 (61.15%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIA---KRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIE------KGKGSG 398
            YVHRVGRTARAGR G A+T   + DR ++KA     K  G+K+ SR++      KW   I++M+D++  ILQ       L + EM+  K EN+I H+EEI ARPKRTWF T+++KK A +  +A +       K KG+G
Sbjct:  599 YVHRVGRTARAGRSGVAITLAAEPDRKVVKAAVRAGKAQGAKIISRVIDAADADKWQDQIDEMDDEIDEILQEEKEEKQLAQIEMQVKKGENLIKHEEEIHARPKRTWFETQEDKKKAKELGRAELNGVRDAMKKKGAG 737          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_NEUCR (ATP-dependent RNA helicase drs-1 OS=Neurospora crassa GN=drs-1 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 7.338e-25
Identity = 56/126 (44.44%), Postives = 80/126 (63.49%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA---GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASI 377
            YVHRVGRTARAGR G A+T   + DR ++KA  K     G+K+ SRI+      KW   I+++ED++  I+Q       L+  EM+  K ENMI +++EI +RPKRTWF T+++KK A  A +A +
Sbjct:  622 YVHRVGRTARAGRSGTAITLAAEPDRKVVKAAVKAGKSQGAKISSRIIDPADADKWQAEIDELEDEIEEIMQEEKEEKQLQNMEMQVKKGENMIKYEDEISSRPKRTWFETQEDKKKAKAAGRAEL 747          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_ASPOR (ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae GN=drs1 PE=3 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 2.135e-24
Identity = 55/126 (43.65%), Postives = 83/126 (65.87%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA---GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASI 377
            Y+HRVGRTARAGR G A T   + DR ++KA  K +   G+K+ SR+V      +W++  + +E+++ A+L+       L +AEM+ T++ENMI H+ EI +RPKRTWF +E+EK L+ KA  A +
Sbjct:  631 YLHRVGRTARAGRSGRACTIAAEPDRKVVKAAVKASKAQGAKVASRVVDPAVADRWAQKAKDLEEEINAVLEEEKIEKQLAQAEMQVTRSENMIKHEAEIMSRPKRTWFASEREKILSKKAGAAEL 756          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_BOTFB (ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 6.212e-24
Identity = 56/120 (46.67%), Postives = 75/120 (62.50%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA---GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVK 359
            Y+HRVGRTARAGR G A T   + DR ++KA  K +   G+K+ SR++       WS+ +++M D++  IL+      IL +AEME  K +N I H+ EI  RPKRTWF TEKEK  A K
Sbjct:  597 YLHRVGRTARAGRSGRACTIAAEPDRKVVKAAVKASRTQGAKVVSRVIEASEADSWSEKVDEMADEIEEILKEEKEDKILAQAEMEVRKGQNFIDHEAEIKGRPKRTWFETEKEKLAAKK 716          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_CRYNE (ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans GN=DRS1 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.083e-23
Identity = 52/121 (42.98%), Postives = 81/121 (66.94%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA-GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADK 368
            Y HRVGRTARAGR+G +V+ V + DR +LKA  K+A   +++ RI+  +++T   + +E+ +D +  IL+      +LR+A+ME  K +NM+ H+ EIF+RP RTWF + KEK+ +  A K
Sbjct:  553 YTHRVGRTARAGRKGRSVSLVGEADRKMLKAAIKQAEADQVRHRIIPSEAVTAMKEKLEEFKDDIQEILKEEKEEKLLRQADMEIKKGQNMVEHEAEIFSRPARTWFQSGKEKQASKSAGK 673          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_ASPTN (ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.083e-23
Identity = 54/126 (42.86%), Postives = 79/126 (62.70%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA---GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASI 377
            Y+HRVGRTARAGR G A T   + DR ++KA  K +   G+K+ SR+V      +W+K    +E+++  +L+       L +AEM+ TK EN+I H+ EI +RPKRTWF +EK+K+ A K   A +
Sbjct:  633 YLHRVGRTARAGRSGRACTIAAEPDRKVVKAAVKASKAQGAKVASRVVDPAVADQWAKKAADLEEEINEVLEEEKTEKQLAQAEMQVTKGENLIKHEAEIMSRPKRTWFESEKDKRAARKLGAAQL 758          
BLAST of CF504130 vs. ExPASy Swiss-Prot
Match: DRS1_ASPNC (ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.083e-23
Identity = 55/126 (43.65%), Postives = 76/126 (60.32%), Query Frame = 3
Query:    9 YVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRA---GSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASI 377
            Y+HRVGRTARAGR G A T   + DR ++KA  K     G+K+ SR++       W+   E++ D+V  +L        L +AEM+ TK EN+I H+ EI +RPKRTWF TE++KK A K   A +
Sbjct:  635 YLHRVGRTARAGRSGRACTIAAEPDRKVVKAAVKAGKSQGAKIASRVIEPAVADSWAAKAEELADEVEEVLSEEKLEKQLAQAEMQVTKGENLIKHEAEIKSRPKRTWFETERDKKAARKLGAAEL 760          
The following BLAST results are available for this feature:
BLAST of CF504130 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
RH28_ORYSJ2.676e-5170.34DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sa... [more]
RH28_ARATH1.124e-4966.90DEAD-box ATP-dependent RNA helicase 28 OS=Arabidop... [more]
DRS1_MAGGR1.747e-2646.03ATP-dependent RNA helicase DRS1 OS=Magnaporthe gri... [more]
DRS1_CHAGB1.132e-2543.88ATP-dependent RNA helicase DRS1 OS=Chaetomium glob... [more]
DRS1_NEUCR7.338e-2544.44ATP-dependent RNA helicase drs-1 OS=Neurospora cra... [more]
DRS1_ASPOR2.135e-2443.65ATP-dependent RNA helicase drs1 OS=Aspergillus ory... [more]
DRS1_BOTFB6.212e-2446.67ATP-dependent RNA helicase drs1 OS=Botryotinia fuc... [more]
DRS1_CRYNE3.083e-2342.98ATP-dependent RNA helicase DRS1 OS=Cryptococcus ne... [more]
DRS1_ASPTN3.083e-2342.86ATP-dependent RNA helicase drs1 OS=Aspergillus ter... [more]
DRS1_ASPNC3.083e-2343.65ATP-dependent RNA helicase drs1 OS=Aspergillus nig... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-618 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_B10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504130 ID=CF504130|Name=CF504130|organism=Citrus sinensis|type=EST|length=472bp
TTACTAGCTATGTTCATCGAGTGGGACGTACAGCAAGAGCTGGTAGAGAG
GGATATGCTGTTACTTTTGTGACGGACAATGATCGTTCTCTTTTAAAAGC
CATTGCTAAGAGAGCTGGTTCCAAGTTGAAGAGCCGAATCGTCGCCGAGC
AATCAATTACTAAGTGGTCTAAAATAATTGAACAAATGGAAGATCAAGTA
GCTGCTATTCTTCAAGAAGAAAGGGAAGAGAGAATCCTGAGAAAAGCTGA
AATGGAAGCAACAAAGGCAGAAAATATGATTGCTCATAAGGAAGAAATTT
TTGCACGCCCTAAAAGAACTTGGTTTGTGACAGAAAAGGAGAAAAAGCTT
GCAGTAAAGGCAGATAAGGCATCTATTGAAAAAGGAAAAGGGTCTGGAAA
TGAGGTGACAAGTGCTCAACAGGCTGAAGACCTTAAAATAAAGGAAAAGA
GGAAGCGAGAACGTGAGAAAAA
back to top