CF504131

Overview
NameCF504131
Unique NameCF504131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length342
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF504131_ssr283 microsatellite CF504131_ssr283:283..298. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10947 contig Csv1_Contig10947:167..505. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.413e-24
Identity = 30/34 (88.24%), Postives = 31/34 (91.18%), Query Frame = 2
Query:   92 GRFLKTAAYGHFGRDDPDFTWEIVKPLK*EKLPA 193
            GRFLKTAAYGHFGRDDPDFTWE+VKPLK EK  A
Sbjct:  360 GRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKTQA 393          

HSP 2 Score: 63.929 bits (154), Expect = 2.413e-24
Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            D+EILKIVKENFDFRPGMISINLDLKRGGN + L+
Sbjct:  330 DREILKIVKENFDFRPGMISINLDLKRGGNGRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.086e-24
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2
Query:   92 GRFLKTAAYGHFGRDDPDFTWEIVKPLK*EK 184
            GRFLKTAAYGHFGRDDPDFTWE+VKPLK EK
Sbjct:  360 GRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          

HSP 2 Score: 63.929 bits (154), Expect = 4.086e-24
Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            DKEILKIVKENFDFRPGM+SINLDLKRGGN + L+
Sbjct:  330 DKEILKIVKENFDFRPGMMSINLDLKRGGNGRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK5_VITVI (S-adenosylmethionine synthetase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.087e-24
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2
Query:   92 GRFLKTAAYGHFGRDDPDFTWEIVKPLK*EK 184
            GRFLKTAAYGHFGRDDPDFTWE+VKPLK EK
Sbjct:  360 GRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          

HSP 2 Score: 63.929 bits (154), Expect = 4.087e-24
Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            DKEILKIVKENFDFRPGMI+INLDLKRGGN + L+
Sbjct:  330 DKEILKIVKENFDFRPGMIAINLDLKRGGNGRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK2_BETVU (S-adenosylmethionine synthetase 2 OS=Beta vulgaris GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 6.920e-24
Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 2
Query:   92 GRFLKTAAYGHFGRDDPDFTWEIVKPLK*EKLPA 193
            GRF KTAAYGHFGRDDPDFTWE+VKPLK EK+PA
Sbjct:  360 GRFQKTAAYGHFGRDDPDFTWEVVKPLKWEKIPA 393          

HSP 2 Score: 60.4622 bits (145), Expect = 6.920e-24
Identity = 28/30 (93.33%), Postives = 29/30 (96.67%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGN 90
            DKEILKIVKE FDFRPGM+SINLDLKRGGN
Sbjct:  330 DKEILKIVKETFDFRPGMMSINLDLKRGGN 359          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK1_SOLLC (S-adenosylmethionine synthetase 1 OS=Solanum lycopersicum GN=SAM1 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.920e-24
Identity = 30/35 (85.71%), Postives = 34/35 (97.14%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            D+EILKIVKENFDFRPGM+SINLDLKRGGNR+ L+
Sbjct:  330 DREILKIVKENFDFRPGMMSINLDLKRGGNRRFLK 364          

HSP 2 Score: 65.0846 bits (157), Expect = 6.920e-24
Identity = 28/30 (93.33%), Postives = 29/30 (96.67%), Query Frame = 2
Query:   95 RFLKTAAYGHFGRDDPDFTWEIVKPLK*EK 184
            RFLKTAAYGHFGRDDPDFTWE+VKPLK EK
Sbjct:  361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK1_CATRO (S-adenosylmethionine synthetase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.172e-23
Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 2
Query:   89 TGRFLKTAAYGHFGRDDPDFTWEIVKPLK*EK 184
            +GRFLKTAAYGHFGRDDPDFTWE+VKPLK EK
Sbjct:  359 SGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          

HSP 2 Score: 62.003 bits (149), Expect = 1.172e-23
Identity = 29/35 (82.86%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            DKEILKIVKENFDFRPGMI+INLDLKRGG+ + L+
Sbjct:  330 DKEILKIVKENFDFRPGMIAINLDLKRGGSGRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK_LITCN (S-adenosylmethionine synthetase OS=Litchi chinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.172e-23
Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 2
Query:   92 GRFLKTAAYGHFGRDDPDFTWEIVKPLK*EKLPA 193
            GRFLKTAAYGHFGR+DPDFTWE+VKPLK +K+ A
Sbjct:  360 GRFLKTAAYGHFGREDPDFTWEVVKPLKWDKVQA 393          

HSP 2 Score: 63.5438 bits (153), Expect = 1.172e-23
Identity = 29/35 (82.86%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            D+EILKIVKENFDFRPGMIS+NLDLKRGGN + L+
Sbjct:  330 DREILKIVKENFDFRPGMISVNLDLKRGGNGRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK4_VITVI (S-adenosylmethionine synthetase 4 OS=Vitis vinifera GN=METK4 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.525e-23
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2
Query:   92 GRFLKTAAYGHFGRDDPDFTWEIVKPLK*EK 184
            GRFLKTAAYGHFGRDDPDFTWE+VKPLK EK
Sbjct:  360 GRFLKTAAYGHFGRDDPDFTWEVVKPLKAEK 390          

HSP 2 Score: 62.003 bits (149), Expect = 1.525e-23
Identity = 29/35 (82.86%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            DKEILKIVKE+FDFRPGMI+INLDLKRGGN + L+
Sbjct:  330 DKEILKIVKESFDFRPGMIAINLDLKRGGNGRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.525e-23
Identity = 29/30 (96.67%), Postives = 29/30 (96.67%), Query Frame = 2
Query:   95 RFLKTAAYGHFGRDDPDFTWEIVKPLK*EK 184
            RFLKTAAYGHFGRDDPDFTWEIVKPLK EK
Sbjct:  361 RFLKTAAYGHFGRDDPDFTWEIVKPLKWEK 390          

HSP 2 Score: 63.929 bits (154), Expect = 1.525e-23
Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            DKEILKIVKENFDFRPGMI+INLDLKRGGN + L+
Sbjct:  330 DKEILKIVKENFDFRPGMITINLDLKRGGNDRFLK 364          
BLAST of CF504131 vs. ExPASy Swiss-Prot
Match: METK2_CATRO (S-adenosylmethionine synthetase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.525e-23
Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 2
Query:   95 RFLKTAAYGHFGRDDPDFTWEIVKPLK*EKLPA 193
            RFLKTAAYGHFGR+DPDFTWE+VKPLK EK+ A
Sbjct:  361 RFLKTAAYGHFGREDPDFTWEVVKPLKFEKVEA 393          

HSP 2 Score: 64.3142 bits (155), Expect = 1.525e-23
Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
Query:    1 DKEILKIVKENFDFRPGMISINLDLKRGGNRQVLE 105
            DKEILKIVKENFDFRPGMI+INLDLKRGGN + L+
Sbjct:  330 DKEILKIVKENFDFRPGMIAINLDLKRGGNSRFLK 364          
The following BLAST results are available for this feature:
BLAST of CF504131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 79
Match NameE-valueIdentityDescription
METK2_VITVI2.413e-2488.24S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]
METK1_SOLTU4.086e-2493.55S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK5_VITVI4.087e-2493.55S-adenosylmethionine synthetase 5 OS=Vitis vinifer... [more]
METK2_BETVU6.920e-2488.24S-adenosylmethionine synthetase 2 OS=Beta vulgaris... [more]
METK1_SOLLC6.920e-2485.71S-adenosylmethionine synthetase 1 OS=Solanum lycop... [more]
METK1_CATRO1.172e-2390.63S-adenosylmethionine synthetase 1 OS=Catharanthus ... [more]
METK_LITCN1.172e-2382.35S-adenosylmethionine synthetase OS=Litchi chinensi... [more]
METK4_VITVI1.525e-2393.55S-adenosylmethionine synthetase 4 OS=Vitis vinifer... [more]
METK2_ELAUM1.525e-2396.67S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK2_CATRO1.525e-2384.85S-adenosylmethionine synthetase 2 OS=Catharanthus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-619 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_B11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504131 ID=CF504131|Name=CF504131|organism=Citrus sinensis|type=EST|length=342bp
GACAAGGAAATTTTGAAGATTGTGAAGGAGAATTTTGATTTTAGGCCTGG
GATGATTTCTATTAATCTTGATCTCAAGAGGGGTGGCAACCGGCAGGTTC
TTGAAGACTGCCGCTTATGGGCACTTTGGCAGAGATGATCCTGATTTCAC
TTGGGAGATTGTTAAGCCACTCAAGTAGGAGAAACTTCCAGCTTAAACTA
ATCAAGGATGAGCTGCTGGCCTCTCATTGGTTCTTATATATGCTTACTTT
TTTTTTTACTTTTGTTTCAGTTACATGAATGTTTTCTTTCTTTCTTTCTT
TTTCTTTTCCTTTTTTTTTTTTTTTATAAATATGTTTAATGG
back to top