CF504134

Overview
NameCF504134
Unique NameCF504134
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length318
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig522 contig Csv1_Contig522:1..318. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504134 vs. ExPASy Swiss-Prot
Match: SYP61_ARATH (Syntaxin-61 OS=Arabidopsis thaliana GN=SYP61 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.272e-36
Identity = 70/89 (78.65%), Postives = 79/89 (88.76%), Query Frame = 1
Query:   49 MSSAQDPFYIVKEEIQDSIDKLQSTFHQWENSASDPGEQVHLKKELLAGCESIEWQVDELDKAIGVASRDPSWYGIDDIELEKRRRWTS 315
            MSSAQDPFYIVKEEIQDSIDKLQSTFH+WE  + D G+Q H+ KEL+A C SIEWQVDEL+KAI VA++DPSWYGID+ ELEKRRRWTS
Sbjct:    1 MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAHVAKELVATCGSIEWQVDELEKAITVAAKDPSWYGIDEAELEKRRRWTS 89          
The following BLAST results are available for this feature:
BLAST of CF504134 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SYP61_ARATH2.272e-3678.65Syntaxin-61 OS=Arabidopsis thaliana GN=SYP61 PE=1 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-622 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_C03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504134 ID=CF504134|Name=CF504134|organism=Citrus sinensis|type=EST|length=318bp
GAGCAATCTCGTCATCGCCACCTCCTTTTCCGGACACCGGATTAAATTAT
GTCTTCTGCTCAAGATCCATTCTATATCGTTAAAGAAGAGATTCAAGATT
CTATTGATAAGTTGCAATCTACTTTCCATCAATGGGAAAATAGTGCTTCT
GATCCTGGGGAGCAAGTACATTTGAAGAAGGAACTACTCGCCGGTTGTGA
GAGCATTGAGTGGCAGGTAGATGAATTGGACAAAGCAATTGGTGTGGCAA
GCAGAGATCCTTCTTGGTATGGTATTGATGACATTGAACTTGAAAAACGA
AGGAGATGGACCAGCACT
back to top