CF504140

Overview
NameCF504140
Unique NameCF504140
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length445
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT13_ARATH (Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 5.704e-63
Identity = 111/132 (84.09%), Postives = 122/132 (92.42%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TWFLLD+A+YSQNLFQKDIF+AIGWIPKA TMNAI EV+KIARAQTLIALCSTVPGYWFTVA ID IGRFAIQLMGFF MTVFMFA+A PY+HW LPD+RIGFVV+YSLTFFF+NFGPN TTF+ P
Sbjct:  297 LLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIARAQTLIALCSTVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAIAFPYNHWILPDNRIGFVVMYSLTFFFANFGPNATTFIVP 428          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT14_ARATH (Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 4.829e-62
Identity = 109/132 (82.58%), Postives = 124/132 (93.94%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TWFLLD+A+YSQNLFQKDIF+AIGWIP A++MNAI+EV+KIARAQTLIALCSTVPGYWFTVA ID IGRFAIQ+MGFFFMTVFMFALAIPY+HWT  ++RIGFV++YSLTFFF+NFGPN TTFV P
Sbjct:  298 LLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIALCSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLTFFFANFGPNATTFVVP 429          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT17_ARATH (Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 6.306e-62
Identity = 110/132 (83.33%), Postives = 122/132 (92.42%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TWFLLD+A+YSQNLFQKDIF+AIGWIP A+TMNAI+EV+KIARAQTLIALCSTVPGYWFTVA ID IGRFAIQ+MGFFFMTVFMFALAIPY HWT  ++RIGFV +YSLTFFF+NFGPN TTFV P
Sbjct:  294 LLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIALCSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVAMYSLTFFFANFGPNATTFVVP 425          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT18_ORYSJ (Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 3.527e-61
Identity = 100/132 (75.76%), Postives = 117/132 (88.64%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GT  TWFLLD+A+YSQNLFQKDIFT+I WIPKAKTM+A+EEV++IARAQTLIALC TVPGYWFTV LID +GRFAIQL+GFF MTVFM  LA+PYHHWT   + IGFVV+Y+ TFFF+NFGPN+TTF+ P
Sbjct:  302 LVGTATTWFLLDIAFYSQNLFQKDIFTSINWIPKAKTMSALEEVFRIARAQTLIALCGTVPGYWFTVFLIDIVGRFAIQLLGFFMMTVFMLGLAVPYHHWTTKGNHIGFVVMYAFTFFFANFGPNSTTFIVP 433          

HSP 2 Score: 30.8018 bits (68), Expect = 3.527e-61
Identity = 12/15 (80.00%), Postives = 13/15 (86.67%), Query Frame = 1
Query:    4 FGLFSAKFVRRHGLH 48
            FGLFS +F RRHGLH
Sbjct:  287 FGLFSRQFARRHGLH 301          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT12_ARATH (Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 1.007e-59
Identity = 105/132 (79.55%), Postives = 118/132 (89.39%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TWFLLD+A+YSQNLFQKDIF+AIGWIPKA TMNA  EV++IARAQTLIALCSTVPGYWFTVA ID IGRF IQL GFF MTVFMFA+A PY+HW  P++RIGFVV+YSLTFFF+NFGPN TTF+ P
Sbjct:  297 LLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIALCSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLTFFFANFGPNATTFIVP 428          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT11_ARATH (Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 1.007e-59
Identity = 105/132 (79.55%), Postives = 118/132 (89.39%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TWFLLD+A+YSQNLFQKDIF+AIGWIPKA TMNA  EV++IARAQTLIALCSTVPGYWFTVA ID IGRF IQL GFF MTVFMFA+A PY+HW  P++RIGFVV+YSLTFFF+NFGPN TTF+ P
Sbjct:  297 LLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIALCSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLTFFFANFGPNATTFIVP 428          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT15_ARATH (Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 3.207e-59
Identity = 99/132 (75.00%), Postives = 115/132 (87.12%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TWFLLD+AYYS NLFQKDI+TAIGWIP A+TMNAI EV+ +++AQTLIALC TVPGYWFTVA ID +GRF IQLMGF FMT+FMFALAIPY HW   ++RIGF+++YSLT FF+NFGPN TTFV P
Sbjct:  299 LLGTTTTWFLLDIAYYSSNLFQKDIYTAIGWIPAAETMNAIHEVFTVSKAQTLIALCGTVPGYWFTVAFIDILGRFFIQLMGFIFMTIFMFALAIPYDHWRHRENRIGFLIMYSLTMFFANFGPNATTFVVP 430          

HSP 2 Score: 29.6462 bits (65), Expect = 3.207e-59
Identity = 11/15 (73.33%), Postives = 13/15 (86.67%), Query Frame = 1
Query:    4 FGLFSAKFVRRHGLH 48
            FGLF+ +F RRHGLH
Sbjct:  284 FGLFTREFARRHGLH 298          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT16_ORYSJ (Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.453e-59
Identity = 95/133 (71.43%), Postives = 117/133 (87.97%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLP-DHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GT+ TW LLD+A+YSQNLFQKDIF+A+GWIPKA TM+A+EE+++IARAQTLIALC TVPGYWFTVALID +GRF IQ +GFF MT+FM  LA+PYHHWT P  + +GF++LY LTFFF+NFGPN+TTF+ P
Sbjct:  299 LVGTSATWLLLDIAFYSQNLFQKDIFSAVGWIPKAATMSALEELFRIARAQTLIALCGTVPGYWFTVALIDVVGRFKIQAVGFFMMTLFMLTLALPYHHWTAPGKNHVGFLLLYGLTFFFANFGPNSTTFIVP 431          

HSP 2 Score: 32.7278 bits (73), Expect = 5.453e-59
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:    4 FGLFSAKFVRRHGLH 48
            FGLFS +FVRRHGLH
Sbjct:  284 FGLFSGEFVRRHGLH 298          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT17_ORYSJ (Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 7.977e-57
Identity = 100/132 (75.76%), Postives = 115/132 (87.12%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+GTT TW LLD+AYYSQNLFQKDIF+AIGWIP+AKTM+A++E+Y IARAQTLIALC TVPGYWFTVALID +GRF IQ  GFF MT FM ALA+PY HWT   ++IGFVVLY+LTFFF+NFGPN TTF+ P
Sbjct:  300 LLGTTSTWLLLDIAYYSQNLFQKDIFSAIGWIPEAKTMSALDELYHIARAQTLIALCGTVPGYWFTVALIDVVGRFKIQAAGFFVMTAFMLALAVPYDHWTAAGNQIGFVVLYALTFFFANFGPNATTFIVP 431          
BLAST of CF504140 vs. ExPASy Swiss-Prot
Match: PHT12_ORYSJ (Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 7.977e-57
Identity = 97/132 (73.48%), Postives = 114/132 (86.36%), Query Frame = 3
Query:   48 LIGTTVTWFLLDVAYYSQNLFQKDIFTAIGWIPKAKTMNAIEEVYKIARAQTLIALCSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLPDHRIGFVVLYSLTFFFSNFGPNTTTFVGP 443
            L+ TT TWFLLD+A+YSQNLFQKDIF+ +GWIP AKTMNA+EE+Y+I+RAQ LIALC T+PGYWFTVA ID +GRF IQ+MGFF MTVFM AL +PY HWT P H  GFVVLY+LTFFF+NFGPN+TTF+ P
Sbjct:  297 LLATTSTWFLLDIAFYSQNLFQKDIFSKVGWIPPAKTMNALEELYRISRAQALIALCGTIPGYWFTVAFIDIVGRFWIQIMGFFMMTVFMLALGVPYDHWTHPAHHTGFVVLYALTFFFANFGPNSTTFIVP 428          
The following BLAST results are available for this feature:
BLAST of CF504140 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
PHT13_ARATH5.704e-6384.09Probable inorganic phosphate transporter 1-3 OS=Ar... [more]
PHT14_ARATH4.829e-6282.58Inorganic phosphate transporter 1-4 OS=Arabidopsis... [more]
PHT17_ARATH6.306e-6283.33Probable inorganic phosphate transporter 1-7 OS=Ar... [more]
PHT18_ORYSJ3.527e-6175.76Probable inorganic phosphate transporter 1-8 OS=Or... [more]
PHT12_ARATH1.007e-5979.55Probable inorganic phosphate transporter 1-2 OS=Ar... [more]
PHT11_ARATH1.007e-5979.55Inorganic phosphate transporter 1-1 OS=Arabidopsis... [more]
PHT15_ARATH3.207e-5975.00Probable inorganic phosphate transporter 1-5 OS=Ar... [more]
PHT16_ORYSJ5.453e-5971.43Inorganic phosphate transporter 1-6 OS=Oryza sativ... [more]
PHT17_ORYSJ7.977e-5775.76Probable inorganic phosphate transporter 1-7 OS=Or... [more]
PHT12_ORYSJ7.977e-5773.48Inorganic phosphate transporter 1-2 OS=Oryza sativ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-628 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_C11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504140 ID=CF504140|Name=CF504140|organism=Citrus sinensis|type=EST|length=445bp
GACTTTGGTTTGTTTAGCGCAAAGTTTGTTCGCCGCCATGGACTTCACTG
ATTGGAACCACAGTCACCTGGTTTTTGTTGGACGTTGCATACTACAGTCA
GAACCTATTCCAAAAGGACATTTTCACTGCCATTGGTTGGATTCCTAAGG
CCAAAACCATGAATGCAATTGAAGAAGTATACAAAATTGCTAGGGCACAA
ACGCTCATTGCTCTTTGCAGCACTGTGCCTGGATACTGGTTCACTGTGGC
ATTAATCGACAAGATAGGAAGATTTGCCATTCAATTGATGGGTTTCTTCT
TCATGACAGTCTTCATGTTTGCATTAGCCATTCCTTATCATCACTGGACT
TTGCCGGATCACCGAATTGGGTTTGTTGTGCTCTACTCACTGACCTTCTT
CTTCTCCAACTTTGGCCCCAATACCACCACATTTGTTGGTCCGGC
back to top