CF504141

Overview
NameCF504141
Unique NameCF504141
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length481
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13838 contig Csv1_Contig13838:9..489. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_MAIZE (40S ribosomal protein S11 OS=Zea mays GN=RPS11 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 7.666e-65
Identity = 119/133 (89.47%), Postives = 120/133 (90.23%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAFLKQPKVFLSS             NRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS
Sbjct:    1 MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 133          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_EUPES (40S ribosomal protein S11 OS=Euphorbia esula GN=RPS11 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 3.805e-64
Identity = 116/133 (87.22%), Postives = 120/133 (90.23%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAFLKQPKVFL+S             NRFWKSIGLGFKTPREAI+GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNIPAH+SPCFRVKEGDHVIIGQCRPLS
Sbjct:    1 MAEQTEKAFLKQPKVFLASKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIDGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPLS 133          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_SOYBN (40S ribosomal protein S11 OS=Glycine max GN=RPS11 PE=2 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 5.494e-63
Identity = 116/133 (87.22%), Postives = 118/133 (88.72%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAFLKQPKVFLS+             NRFWKSIGLGFKTPREAIEGTYIDKKCPFTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNIPAHISP FRVKEGDHVIIGQCRPLS
Sbjct:    1 MAEQTEKAFLKQPKVFLSTKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKEGDHVIIGQCRPLS 133          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS113_ARATH (40S ribosomal protein S11-3 OS=Arabidopsis thaliana GN=RPS11C PE=2 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 2.088e-62
Identity = 114/133 (85.71%), Postives = 117/133 (87.97%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAFLKQPKVFLSS             NRFWK+IGLGFKTPREAI+G YID KCPFTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNIPAH+SPCFRVKEGDHVIIGQCRPLS
Sbjct:    1 MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPLS 133          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS111_ARATH (40S ribosomal protein S11-1 OS=Arabidopsis thaliana GN=RPS11A PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 3.561e-62
Identity = 112/133 (84.21%), Postives = 118/133 (88.72%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAFLKQPKVFLSS             NRFWK+IGLGFKTPREAI+G Y+DKKCPFTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNIPAH+SPCFRVKEGDH+IIGQCRPLS
Sbjct:    1 MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHIIIGQCRPLS 133          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS112_ARATH (40S ribosomal protein S11-2 OS=Arabidopsis thaliana GN=RPS11B PE=2 SV=2)

HSP 1 Score: 231.491 bits (589), Expect = 1.496e-60
Identity = 111/133 (83.46%), Postives = 117/133 (87.97%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAFLKQPKVFLSS             NRFWK+IGLGFKTPREAIEGTYID+KCPFTGTVSIRGRIL+GTCHSAKM RTIIVRR+YLHFVKKY+RYEKRHSNIPAH+SPCFRVKEGD V IGQCRPLS
Sbjct:    1 MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDQKCPFTGTVSIRGRILSGTCHSAKMQRTIIVRRDYLHFVKKYRRYEKRHSNIPAHVSPCFRVKEGDRVTIGQCRPLS 133          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_DUNTE (40S ribosomal protein S11 OS=Dunaliella tertiolecta GN=RPS11 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 5.166e-45
Identity = 88/133 (66.17%), Postives = 102/133 (76.69%), Query Frame = 1
Query:   82 MAEQTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            MAEQTEKAF KQ  V                 +RF+K++GL FKTP+EAI+G Y+DKKCPFTG VSIRGRIL G   S+KM RTIIVRR+YLHF+ KY RYEKRH+NIPAH+SPCFRV++GD VIIGQCRPLS
Sbjct:    1 MAEQTEKAFQKQVGV-TGCFKSKEKKAPGKSGHRFFKNVGLNFKTPKEAIDGNYVDKKCPFTGNVSIRGRILTGVVKSSKMMRTIIVRRDYLHFIPKYARYEKRHTNIPAHVSPCFRVRDGDTVIIGQCRPLS 132          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_DICDI (40S ribosomal protein S11 OS=Dictyostelium discoideum GN=rps11 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.031e-41
Identity = 82/130 (63.08%), Postives = 96/130 (73.85%), Query Frame = 1
Query:   91 QTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKEGDHVIIGQCRPLS 480
            Q EKAF KQ   F +               R++K+IGLG++TP++AIEGTYIDKKCPFT  VSIRG IL GT  S KM RT++VRRNYLH++KKY R+EKRHSNIPAH+SP F VKEGD V IGQCRPLS
Sbjct:    5 QAEKAFQKQQVSFKNRFQLKASKGKEGI--RYYKNIGLGYRTPKDAIEGTYIDKKCPFTSDVSIRGAILRGTVISTKMRRTLVVRRNYLHYIKKYNRFEKRHSNIPAHVSPAFNVKEGDSVTIGQCRPLS 132          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_XENLA (40S ribosomal protein S11 OS=Xenopus laevis GN=rps11 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 4.526e-41
Identity = 76/131 (58.02%), Postives = 98/131 (74.81%), Query Frame = 1
Query:   91 QTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFR-VKEGDHVIIGQCRPLS 480
            QTE+A+ KQP +F +               R+++S+GLGFKTPREAI+GTYIDKKCPFTG VSIRGRIL+G     KM RTI++RR+YLH+++KY R+EKRH N+  H+SPCFR V+ GD V +G+CRPLS
Sbjct:    5 QTERAYQKQPTIFQNKKRVLEGETGKEKLPRYYRSVGLGFKTPREAIDGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQVGDTVTVGECRPLS 135          
BLAST of CF504141 vs. ExPASy Swiss-Prot
Match: RS11_RAT (40S ribosomal protein S11 OS=Rattus norvegicus GN=Rps11 PE=1 SV=3)

HSP 1 Score: 166.392 bits (420), Expect = 5.911e-41
Identity = 77/131 (58.78%), Postives = 98/131 (74.81%), Query Frame = 1
Query:   91 QTEKAFLKQPKVFLSSXXXXXXXXXXXXXNRFWKSIGLGFKTPREAIEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFR-VKEGDHVIIGQCRPLS 480
            QTE+A+ KQP +F +               R++K+IGLGFKTP+EAIEGTYIDKKCPFTG VSIRGRIL+G     KM RTI++RR+YLH+++KY R+EKRH N+  H+SPCFR V+ GD V +G+CRPLS
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLS 135          
The following BLAST results are available for this feature:
BLAST of CF504141 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
RS11_MAIZE7.666e-6589.4740S ribosomal protein S11 OS=Zea mays GN=RPS11 PE=... [more]
RS11_EUPES3.805e-6487.2240S ribosomal protein S11 OS=Euphorbia esula GN=RP... [more]
RS11_SOYBN5.494e-6387.2240S ribosomal protein S11 OS=Glycine max GN=RPS11 ... [more]
RS113_ARATH2.088e-6285.7140S ribosomal protein S11-3 OS=Arabidopsis thalian... [more]
RS111_ARATH3.561e-6284.2140S ribosomal protein S11-1 OS=Arabidopsis thalian... [more]
RS112_ARATH1.496e-6083.4640S ribosomal protein S11-2 OS=Arabidopsis thalian... [more]
RS11_DUNTE5.166e-4566.1740S ribosomal protein S11 OS=Dunaliella tertiolect... [more]
RS11_DICDI2.031e-4163.0840S ribosomal protein S11 OS=Dictyostelium discoid... [more]
RS11_XENLA4.526e-4158.0240S ribosomal protein S11 OS=Xenopus laevis GN=rps... [more]
RS11_RAT5.911e-4158.7840S ribosomal protein S11 OS=Rattus norvegicus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-629 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_C12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504141 ID=CF504141|Name=CF504141|organism=Citrus sinensis|type=EST|length=481bp
ATTTAGGGTTTTCTGCATTGTGTTATCCACCTCCGCCCAGTGCGTTCATC
ATCCTCAACAACTCAGCCCCGAAATCCAGCCATGGCGGAGCAGACCGAGA
AGGCGTTTTTGAAGCAGCCCAAGGTGTTTCTCAGCTCGAAGAAGGCAGGA
AAAGGAAAGAGGCCAGGAAAGGGAGGGAATCGATTCTGGAAGAGCATAGG
CTTGGGATTCAAGACTCCCAGAGAGGCAATTGAAGGGACTTACATTGATA
AGAAGTGTCCGTTCACCGGCACTGTTTCCATCAGGGGTCGTATCCTTGCT
GGTACTTGCCACAGTGCTAAGATGAACAGAACCATCATCGTTAGGCGTAA
CTACCTTCACTTTGTGAAGAAATATCAGAGGTATGAGAAGAGGCACTCTA
ACATTCCAGCACACATCTCACCTTGTTTCCGTGTGAAAGAGGGAGACCAT
GTTATCATTGGCCAGTGCAGGCCTTTGTCAA
back to top