CF504144

Overview
NameCF504144
Unique NameCF504144
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length215
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8233 contig Csv1_Contig8233:98..312. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AFB_ARATH (Splicing factor U2af small subunit B OS=Arabidopsis thaliana GN=U2AF35B PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.484e-35
Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTLLLSNMYQRPDMITPGVDPQGQ LDP KIQDHFEDF
Sbjct:   11 TEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITPGVDPQGQPLDPSKIQDHFEDF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AFA_ARATH (Splicing factor U2af small subunit A OS=Arabidopsis thaliana GN=U2AF35A PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 65/71 (91.55%), Postives = 68/71 (95.77%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTLLLSNMYQRPDMITPGVD QGQ LDPRKIQ+HFEDF
Sbjct:   11 TEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITPGVDAQGQPLDPRKIQEHFEDF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AFB_ORYSJ (Splicing factor U2af small subunit B OS=Oryza sativa subsp. japonica GN=U2AF35B PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.176e-32
Identity = 58/71 (81.69%), Postives = 67/71 (94.37%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKDRVNCPFYFKIGACRHGDRCSRLH +P++SPT++L+NMYQRPDMITPGVD QGQ +DP K+Q+HFEDF
Sbjct:   11 TEKDRVNCPFYFKIGACRHGDRCSRLHNRPTVSPTIVLANMYQRPDMITPGVDAQGQPIDPEKMQEHFEDF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AFA_ORYSJ (Splicing factor U2af small subunit A OS=Oryza sativa subsp. japonica GN=U2AF35A PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.300e-31
Identity = 60/71 (84.51%), Postives = 63/71 (88.73%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKDRVNCPFYFKIGACRHGDRCSRLH KPS+SPTLLLSNMY RPDMITPG+D QG  +DP KIQ  FEDF
Sbjct:   11 TEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLSNMYLRPDMITPGIDAQGNPIDPEKIQADFEDF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AF1_MOUSE (Splicing factor U2AF 35 kDa subunit OS=Mus musculus GN=U2af1 PE=2 SV=4)

HSP 1 Score: 88.5817 bits (218), Expect = 1.068e-17
Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKD+VNC FYFKIGACRHGDRCSRLH KP+ S T+ L N+Y+ P   +   D    A+   ++Q+H+++F
Sbjct:   11 TEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AF1_HUMAN (Splicing factor U2AF 35 kDa subunit OS=Homo sapiens GN=U2AF1 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.068e-17
Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKD+VNC FYFKIGACRHGDRCSRLH KP+ S T+ L N+Y+ P   +   D    A+   ++Q+H+++F
Sbjct:   11 TEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AF1_BOVIN (Splicing factor U2AF 35 kDa subunit OS=Bos taurus GN=U2AF1 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.068e-17
Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKD+VNC FYFKIGACRHGDRCSRLH KP+ S T+ L N+Y+ P   +   D    A+   ++Q+H+++F
Sbjct:   11 TEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AF4_RAT (Splicing factor U2AF 26 kDa subunit OS=Rattus norvegicus GN=U2af1l4 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.822e-17
Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKD+VNC FYFKIGACRHGDRCSRLH KP+ S T++L N+Y+ P       D     +   ++Q+H+++F
Sbjct:   11 TEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDVEVQEHYDNF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AF4_MOUSE (Splicing factor U2AF 26 kDa subunit OS=Mus musculus GN=U2af1l4 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.822e-17
Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKD+VNC FYFKIGACRHGDRCSRLH KP+ S T++L N+Y+ P       D     +   ++Q+H+++F
Sbjct:   11 TEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDVEVQEHYDNF 81          
BLAST of CF504144 vs. ExPASy Swiss-Prot
Match: U2AF4_BOVIN (Splicing factor U2AF 26 kDa subunit OS=Bos taurus GN=U2AF1L4 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.822e-17
Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = 3
Query:    3 TEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDF 215
            TEKD+VNC FYFKIGACRHGDRCSRLH KP+ S T++L N+Y+ P       D     +   ++Q+H+++F
Sbjct:   11 TEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDVEVQEHYDNF 81          
The following BLAST results are available for this feature:
BLAST of CF504144 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
U2AFB_ARATH1.484e-3592.96Splicing factor U2af small subunit B OS=Arabidopsi... [more]
U2AFA_ARATH7.363e-3591.55Splicing factor U2af small subunit A OS=Arabidopsi... [more]
U2AFB_ORYSJ1.176e-3281.69Splicing factor U2af small subunit B OS=Oryza sati... [more]
U2AFA_ORYSJ1.300e-3184.51Splicing factor U2af small subunit A OS=Oryza sati... [more]
U2AF1_MOUSE1.068e-1753.52Splicing factor U2AF 35 kDa subunit OS=Mus musculu... [more]
U2AF1_HUMAN1.068e-1753.52Splicing factor U2AF 35 kDa subunit OS=Homo sapien... [more]
U2AF1_BOVIN1.068e-1753.52Splicing factor U2AF 35 kDa subunit OS=Bos taurus ... [more]
U2AF4_RAT1.822e-1752.11Splicing factor U2AF 26 kDa subunit OS=Rattus norv... [more]
U2AF4_MOUSE1.822e-1752.11Splicing factor U2AF 26 kDa subunit OS=Mus musculu... [more]
U2AF4_BOVIN1.822e-1752.11Splicing factor U2AF 26 kDa subunit OS=Bos taurus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-632 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_D04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504144 ID=CF504144|Name=CF504144|organism=Citrus sinensis|type=EST|length=215bp
GAACCGAAAAGGACAGAGTAAACTGTCCGTTCTATTTCAAGATCGGCGCG
TGCAGGCACGGCGATCGATGCTCTCGGCTTCATACGAAGCCCAGCATCAG
CCCCACACTCCTCCTCTCCAACATGTACCAACGCCCCGACATGATCACTC
CCGGCGTTGACCCGCAGGGCCAGGCCCTTGACCCTCGCAAGATCCAAGAT
CACTTCGAGGATTTT
back to top