CF504146

Overview
NameCF504146
Unique NameCF504146
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length260
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7224 contig Csv1_Contig7224:17..276. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504146 vs. ExPASy Swiss-Prot
Match: AGD9_ARATH (Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana GN=AGD9 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.638e-13
Identity = 32/38 (84.21%), Postives = 38/38 (100.00%), Query Frame = 1
Query:  145 MASDNLTDKNLVFRKLKAKSENKMCFDCNAKNPTWASV 258
            MA++NLTDKN+VFRKLK+KSENK+CFDC+AKNPTWASV
Sbjct:    1 MATENLTDKNVVFRKLKSKSENKVCFDCSAKNPTWASV 38          
BLAST of CF504146 vs. ExPASy Swiss-Prot
Match: AGD8_ARATH (Probable ADP-ribosylation factor GTPase-activating protein AGD8 OS=Arabidopsis thaliana GN=AGD8 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.649e-13
Identity = 31/37 (83.78%), Postives = 37/37 (100.00%), Query Frame = 1
Query:  148 ASDNLTDKNLVFRKLKAKSENKMCFDCNAKNPTWASV 258
            ++DNLTDKN+VFRKLK+KSENK+CFDC+AKNPTWASV
Sbjct:    5 SADNLTDKNIVFRKLKSKSENKVCFDCSAKNPTWASV 41          
BLAST of CF504146 vs. ExPASy Swiss-Prot
Match: AGD10_ARATH (ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana GN=AGD10 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.035e-12
Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1
Query:  145 MASDNLTDKNLVFRKLKAKSENKMCFDCNAKNPTWASV 258
            MAS+NL DK  VF+KLKAKS+NK+CFDCNAKNPTWASV
Sbjct:    1 MASENLNDKISVFKKLKAKSDNKICFDCNAKNPTWASV 38          
The following BLAST results are available for this feature:
BLAST of CF504146 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
AGD9_ARATH1.638e-1384.21Probable ADP-ribosylation factor GTPase-activating... [more]
AGD8_ARATH3.649e-1383.78Probable ADP-ribosylation factor GTPase-activating... [more]
AGD10_ARATH4.035e-1281.58ADP-ribosylation factor GTPase-activating protein ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-634 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_D06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504146 ID=CF504146|Name=CF504146|organism=Citrus sinensis|type=EST|length=260bp
TTAACTTAGGAGTGGGGAGGTGTTGTTCCATGCACCTCGTAAGGTTCATA
ATCTCATATTCTCGTTCAGGAAAAAATCAAAATCAAAATTTACAATCTTG
GGGTTTCGTTTTTCGTAATTTTTATTTCATAAAATTCTTTCTCGATGGCT
TCCGATAATTTGACCGATAAGAACCTTGTTTTCAGAAAACTGAAAGCAAA
ATCGGAAAACAAGATGTGTTTTGATTGTAATGCTAAGAACCCCACGTGGG
CCTCGGTGAC
back to top