CF504148

Overview
NameCF504148
Unique NameCF504148
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length255
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504148 vs. ExPASy Swiss-Prot
Match: PP126_ARATH (Pentatricopeptide repeat-containing protein At1g76280 OS=Arabidopsis thaliana GN=At1g76280 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 5.448e-22
Identity = 50/89 (56.18%), Postives = 64/89 (71.91%), Query Frame = 2
Query:    5 NLLKALGAEGMIRELIQYF-------CDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSA 250
            N+L+ALGAEGM+ E+I++          S   LGTPTYN VLHSL+EA E+   + IFK+MK+CG P + ATYNIMIDCCS+I  +KSA
Sbjct:  491 NVLRALGAEGMVNEMIRHLQKAENLSAHSNMYLGTPTYNIVLHSLLEANETDMVINIFKRMKSCGCPADVATYNIMIDCCSLIHSYKSA 579          
The following BLAST results are available for this feature:
BLAST of CF504148 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PP126_ARATH5.448e-2256.18Pentatricopeptide repeat-containing protein At1g76... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-636 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_D08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504148 ID=CF504148|Name=CF504148|organism=Citrus sinensis|type=EST|length=255bp
GAAAAACTTGCTTAAAGCTCTTGGTGCAGAGGGAATGATCAGAGAGCTGA
TCCAGTATTTCTGTGATAGTAAAACTCCCTTGGGAACGCCCACCTATAAT
ACAGTGTTGCATTCGCTTGTAGAAGCTCAGGAAAGTCACAGAGCTATGGA
AATATTTAAACAAATGAAAACTTGTGGTATCCCACCTAATGCTGCAACTT
ACAACATAATGATTGATTGCTGTAGCATTATAAGATGCTTCAAATCTGCT
TCTGC
back to top