CF504151

Overview
NameCF504151
Unique NameCF504151
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length423
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_RAT (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Rattus norvegicus GN=Imp4 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.099e-30
Identity = 66/117 (56.41%), Postives = 82/117 (70.09%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  RLRREYLYRK+ E  +R + EKK ++K AL+E + IPTELR E  AL+  ++ +D       SH+DDEY  A   DPK+++TTSRDPS+ L  F KELK VFP AQRMNRG
Sbjct:    1 MLRREARLRREYLYRKAREEAQRSVQEKKERVKRALEENQLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRG 117          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_MOUSE (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Mus musculus GN=Imp4 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.099e-30
Identity = 66/117 (56.41%), Postives = 82/117 (70.09%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  RLRREYLYRK+ E  +R + EKK ++K AL+E + IPTELR E  AL+  ++ +D       SH+DDEY  A   DPK+++TTSRDPS+ L  F KELK VFP AQRMNRG
Sbjct:    1 MLRREARLRREYLYRKAREEAQRSVQEKKERVKRALEENQLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRG 117          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_BOVIN (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Bos taurus GN=IMP4 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 4.177e-30
Identity = 65/117 (55.56%), Postives = 81/117 (69.23%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  RLRREYLYRK+ E  ER   E+K K++ AL+E + IPTELR E  AL+  ++ +D       +H+DDEY  A   DPK+++TTSRDPS+ L  F KELK VFP AQRMNRG
Sbjct:    1 MLRREARLRREYLYRKAREEAERTAQERKDKVRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTNHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRG 117          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_PONAB (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Pongo abelii GN=IMP4 PE=2 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 9.306e-30
Identity = 64/117 (54.70%), Postives = 81/117 (69.23%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  RLRREYLYRK+ E  +R   E+K +++ AL+E + IPTELR E  AL+  ++ +D       SH+DDEY  A   DPK+++TTSRDPS+ L  F KELK VFP AQRMNRG
Sbjct:    1 MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRG 117          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_HUMAN (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens GN=IMP4 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 9.306e-30
Identity = 64/117 (54.70%), Postives = 81/117 (69.23%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  RLRREYLYRK+ E  +R   E+K +++ AL+E + IPTELR E  AL+  ++ +D       SH+DDEY  A   DPK+++TTSRDPS+ L  F KELK VFP AQRMNRG
Sbjct:    1 MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRG 117          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_YEAST (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Saccharomyces cerevisiae GN=IMP4 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.900e-23
Identity = 59/121 (48.76%), Postives = 82/121 (67.77%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAA---LRQEIDLEDENTAIPRSHIDDEYANATE-RDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  R RREYLYRK+ E ++  L +K++ IK+AL +GKP+P EL  +E+     R +  L++   A     +DDEYA  +   DP+I++TTSRDPS  L+QF KE+K +FPNA R+NRG
Sbjct:    1 MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEA-DDLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRG 120          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: YHPK_CAEEL (Brix domain-containing protein ZK795.3 OS=Caenorhabditis elegans GN=ZK795.3 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 4.187e-22
Identity = 55/117 (47.01%), Postives = 75/117 (64.10%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            M+RR  RLRRE+++RKSLE K++ L EK+ KI+ AL+    I   LR +   L +  D   +     +   D EY  A  +DPKI++TTSRDPS+ L  F KE+K +FPNAQR+NRG
Sbjct:    1 MIRRENRLRREFIFRKSLEEKQKSLEEKREKIRNALENNTKIDYNLRKDAIELAKGSDWGGQ-----QYETDSEYRWAGAQDPKIVITTSRDPSSRLKMFAKEMKLIFPNAQRINRG 112          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_DEBHA (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Debaryomyces hansenii GN=IMP4 PE=3 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 1.218e-21
Identity = 57/118 (48.31%), Postives = 78/118 (66.10%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEY-ANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            M+R+  R RREYLYRKSLE +E  L EK++++K AL  GKP+  EL  ++   +  I  E E T      IDDEY A +   +PK+L+TTSR+PS  L QF KE+K +FPN+ ++NRG
Sbjct:    1 MIRKQARERREYLYRKSLELQESSLTEKRQQLKAALASGKPLSKELAEDKELQKDFIYDESEQT-----EIDDEYSALSGISEPKVLITTSRNPSVKLLQFSKEIKLMFPNSIKLNRG 113          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_YARLI (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Yarrowia lipolytica GN=IMP4 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.591e-21
Identity = 55/118 (46.61%), Postives = 81/118 (68.64%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEY-ANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            M+RR  R RREYLYRKSL+ +E    +K++++K AL  GKP+P ++ ++E  LR+ I  ++      +  IDDEY A +   DPK+++TTSRDPS  L+QF KE+K +FP + R+NRG
Sbjct:    1 MIRRQARERREYLYRKSLQLQEATKIQKRQQLKAALASGKPLPKDVADDE-ELRKTIAYDES----VQDEIDDEYSAMSGITDPKVVVTTSRDPSTRLSQFAKEVKLLFPTSIRLNRG 113          
BLAST of CF504151 vs. ExPASy Swiss-Prot
Match: IMP4_CANGA (U3 small nucleolar ribonucleoprotein protein IMP4 OS=Candida glabrata GN=IMP4 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.591e-21
Identity = 58/124 (46.77%), Postives = 81/124 (65.32%), Query Frame = 2
Query:   71 MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALR------QEIDLEDENTAIPRSHIDDEY-ANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRG 421
            MLRR  R RREYLYRK+ E +E  L +K++ IK+AL +GKP+P EL  +E   +         D EDE      + +DDEY A++   + ++++TTSRDPS+ L QF KE+K +FPNA R+NRG
Sbjct:    1 MLRRQARERREYLYRKAQELQETQLQQKRQIIKQALAQGKPLPKELAEDEQLQKDFRYDQSMADNEDE------AGVDDEYSASSGIVEARVIVTTSRDPSSRLAQFAKEIKLLFPNAVRLNRG 118          
The following BLAST results are available for this feature:
BLAST of CF504151 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
IMP4_RAT1.099e-3056.41U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_MOUSE1.099e-3056.41U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_BOVIN4.177e-3055.56U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_PONAB9.306e-3054.70U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_HUMAN9.306e-3054.70U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_YEAST2.900e-2348.76U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
YHPK_CAEEL4.187e-2247.01Brix domain-containing protein ZK795.3 OS=Caenorha... [more]
IMP4_DEBHA1.218e-2148.31U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_YARLI1.591e-2146.61U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]
IMP4_CANGA1.591e-2146.77U3 small nucleolar ribonucleoprotein protein IMP4 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-639 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_D11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504151 ID=CF504151|Name=CF504151|organism=Citrus sinensis|type=EST|length=423bp
GCTCGCATAAACCTCGACAACACTTAATAGCTCTTCATAAAATTTAGGTC
TTTATCCAAATTCCCCAACGATGTTGCGTCGGAATATTCGATTGAGACGG
GAATACTTATATAGAAAGAGCTTAGAAGGCAAAGAACGCTTGCTCTATGA
GAAGAAGCGCAAAATCAAGGAAGCCTTGCAAGAGGGAAAGCCGATTCCCA
CTGAGCTGAGGAACGAGGAGGCTGCGCTTCGCCAAGAAATTGATCTTGAA
GATGAAAATACAGCTATCCCAAGGAGCCACATTGATGATGAATATGCAAA
TGCGACTGAAAGAGATCCTAAAATTTTGCTGACTACATCAAGGGATCCGA
GTGCTCCTCTTACACAGTTTGTAAAGGAGTTGAAGTTTGTCTTTCCTAAT
GCACAAAGAATGAATCGTGGTGG
back to top