CF504282

Overview
NameCF504282
Unique NameCF504282
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length425
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig446 contig Csv1_Contig446:19..443. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504282 vs. ExPASy Swiss-Prot
Match: JMT_BRARP (Jasmonate O-methyltransferase OS=Brassica rapa subsp. pekinensis GN=JMT PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.528e-27
Identity = 63/138 (45.65%), Postives = 85/138 (61.59%), Query Frame = 1
Query:   25 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPT-KVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQ------LGSASGAAGQCF 417
            MEV+++LHMN G G TSYA NS+VQ  +IS+ + + +EA+ KL    S      IADLGCSSGPN+LL  S +++ +  +C  L   +PE  + LNDLP NDFN IF SL  F   ++K+      LG   G+ G CF
Sbjct:    1 MEVMRILHMNKGNGETSYAKNSIVQSNIISLGRRVMDEALKKLMIRNSEILSFGIADLGCSSGPNSLLSISNIVETIQNLCHDLDRPVPELSLSLNDLPSNDFNYIFASLPEFYDRVKKRDNNYESLGFEHGSGGPCF 138          
BLAST of CF504282 vs. ExPASy Swiss-Prot
Match: JMT_ARATH (Jasmonate O-methyltransferase OS=Arabidopsis thaliana GN=JMT PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 2.882e-26
Identity = 62/135 (45.93%), Postives = 83/135 (61.48%), Query Frame = 1
Query:   25 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSP-TKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKIL---RKQLGSASGAAGQCF 417
            MEV++VLHMN G G TSYA NS  Q  +IS+ + + +EA+ KL  S S  + + IADLGCSSGPN+LL  S ++  ++ +C  L   +PE +V LNDLP NDFN I  SL  F   +   ++ LG   G    CF
Sbjct:    1 MEVMRVLHMNKGNGETSYAKNSTAQSNIISLGRRVMDEALKKLMMSNSEISSIGIADLGCSSGPNSLLSISNIVDTIHNLCPDLDRPVPELRVSLNDLPSNDFNYICASLPEFYDRVNNNKEGLGFGRGGGESCF 135          
BLAST of CF504282 vs. ExPASy Swiss-Prot
Match: BAMT_ANTMA (Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.698e-15
Identity = 46/110 (41.82%), Postives = 70/110 (63.64%), Query Frame = 1
Query:   37 QVLHMN-GGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTS--PTKVAIADLGCSSGPNTLLVASELIKVVNKI-CDKLGSQLPEFQVFLNDLPGNDFNTIFRSLA 354
            ++L MN  G G TSYA+NS +Q+ ++S +  + +E +  +       P    + D+GCSSGPN LLV S +I  +  +  +K  ++LPEF+VFLNDLP NDFN +F+ L+
Sbjct:    6 KLLCMNIAGDGETSYANNSGLQKVMMSKSLHVLDETLKDIIGDHVGFPKCFKMMDMGCSSGPNALLVMSGIINTIEDLYTEKNINELPEFEVFLNDLPDNDFNNLFKLLS 115          
BLAST of CF504282 vs. ExPASy Swiss-Prot
Match: MT799_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.814e-12
Identity = 55/135 (40.74%), Postives = 67/135 (49.63%), Query Frame = 1
Query:   37 QVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTK------LFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDK-----LGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAG 408
            Q   MNGG G  SY  NS  Q+  I  AK  T EA+ K      L  ++    + IAD GCS GPNT  V   +I  V +   K     +G+ L EFQV  ND P NDFNT+FR+    Q I  KQ   + G  G
Sbjct:    6 QSFPMNGGDGPHSYIHNSSYQKVAIDGAKEKTSEAILKNLDLELLNRNSDENILRIADFGCSIGPNTFEVVQNIIDTVKQKNLKENNAYIGAPL-EFQVCFNDQPNNDFNTLFRT----QPISSKQAYLSVGVPG 135          
BLAST of CF504282 vs. ExPASy Swiss-Prot
Match: MT797_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.619e-11
Identity = 47/121 (38.84%), Postives = 60/121 (49.59%), Query Frame = 1
Query:   37 QVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTK------LFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDK-----LGSQLPEFQVFLNDLPGNDFNTIFRSLASFQK 366
            Q   MNGG G  SY  NS  Q+  I   K  T EA+ +      L  ++    + I D GCS GPNT  V   +I  V +   K     +G+ L EFQV  ND P NDFNT+FR+   F +
Sbjct:    6 QSFPMNGGDGPHSYIHNSSYQKVAIDGVKERTSEAILEKLDLEFLNRNSEENILRIVDFGCSIGPNTFDVVQNIIDTVKQKRLKENKTYIGAPL-EFQVCFNDQPNNDFNTLFRTQPFFSR 125          
The following BLAST results are available for this feature:
BLAST of CF504282 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
JMT_BRARP1.528e-2745.65Jasmonate O-methyltransferase OS=Brassica rapa sub... [more]
JMT_ARATH2.882e-2645.93Jasmonate O-methyltransferase OS=Arabidopsis thali... [more]
BAMT_ANTMA8.698e-1541.82Benzoate carboxyl methyltransferase OS=Antirrhinum... [more]
MT799_ARATH1.814e-1240.74Probable S-adenosylmethionine-dependent methyltran... [more]
MT797_ARATH7.619e-1138.84Probable S-adenosylmethionine-dependent methyltran... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-771 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_E06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504282 ID=CF504282|Name=CF504282|organism=Citrus sinensis|type=EST|length=425bp
GAAACAGAGAATACTGTGCGAGAGATGGAGGTGGTCCAAGTGCTTCACAT
GAATGGAGGAGTAGGAGGCACAAGTTATGCCAGTAATTCACTGGTTCAGG
AAAAAGTCATATCCATTGCAAAGCCAATCACAGAGGAAGCCATGACCAAA
CTCTTCTGCAGCACGTCCCCAACAAAGGTAGCAATTGCCGACTTGGGCTG
TTCTTCAGGACCAAACACTTTGCTTGTGGCATCTGAACTTATCAAAGTAG
TGAACAAGATCTGCGATAAGTTGGGCAGTCAATTACCAGAATTTCAAGTG
TTCCTGAACGATCTTCCAGGGAATGACTTTAACACCATTTTCAGGTCTTT
AGCAAGCTTCCAAAAGATACTGAGAAAGCAATTAGGGTCGGCCTCTGGGG
CAGCTGGGCAGTGCTTCTTCACTTG
back to top