CF504284

Overview
NameCF504284
Unique NameCF504284
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length391
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5597 contig Csv1_Contig5597:40..430. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.708e-31
Identity = 55/81 (67.90%), Postives = 64/81 (79.01%), Query Frame = 2
Query:   65 VEADEHTVNSSKGTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            ++ D+ T N+     Y    IDCGGAC ARCRLSSRP LC+RACGTCCARCNCVPPGT+GNTE CPCYA++TTH  +RKCP
Sbjct:   24 IQTDQVTSNAISEAAYSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 4.650e-29
Identity = 58/82 (70.73%), Postives = 62/82 (75.61%), Query Frame = 2
Query:   62 LVEADEHTVNSSKGTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            LV+AD    NS K  GY K  IDCG AC ARCRLS RP LCHRACGTCC RCNCVPPGT GN + C CYA++TTH GRRKCP
Sbjct:   20 LVQADVE--NSQKKNGYAKK-IDCGSACVARCRLSRRPRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.449e-24
Identity = 48/73 (65.75%), Postives = 54/73 (73.97%), Query Frame = 2
Query:   89 NSSKGTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            +S  G G  K  IDCGG C+ RC  SSRPNLC RAC +CC RCNCVPPGTAGN  +CPCYA++TT  GR KCP
Sbjct:   29 DSQVGEGVVK--IDCGGRCKGRCSKSSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.449e-24
Identity = 49/81 (60.49%), Postives = 58/81 (71.60%), Query Frame = 2
Query:   68 EADEHTVNSSK-GTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            E   H  + +K G G  K  IDCGG C+ RC  SSR  LC RAC +CC+RCNCVPPGT+GNT +CPCYA++TTH GR KCP
Sbjct:   21 ELHVHAADGAKVGEGVVK--IDCGGRCKDRCSKSSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: RSI1_SOLLC (Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.746e-12
Identity = 32/73 (43.84%), Postives = 37/73 (50.68%), Query Frame = 2
Query:   89 NSSKGTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            N  +G    +PT DC   C  RC  +S    C   C  CCA C CVP G  GN + CPCY N  T  G+ KCP
Sbjct:   25 NVVEGYNKLRPT-DCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP 96          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: GAST1_SOLLC (Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.151e-11
Identity = 32/71 (45.07%), Postives = 38/71 (53.52%), Query Frame = 2
Query:   95 SKGTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            S+G  +P+   DC   C  RC  +S    C   C  CCA+C CVP GT GN + CPCY N  T  G  KCP
Sbjct:   45 SEGRLHPQ---DCQPKCTYRCSKTSYKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: SNAK1_SOLTU (Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.563e-11
Identity = 25/59 (42.37%), Postives = 31/59 (52.54%), Query Frame = 2
Query:  131 CGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            C   C+ RC  +   + C + CG CC  C CVP GT GN   CPCY +     G+ KCP
Sbjct:   30 CDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP 88          
BLAST of CF504284 vs. ExPASy Swiss-Prot
Match: GASA4_ARATH (Gibberellin-regulated protein 4 OS=Arabidopsis thaliana GN=GASA4 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 3.348e-11
Identity = 30/69 (43.48%), Postives = 34/69 (49.28%), Query Frame = 2
Query:  101 GTGYPKPTIDCGGACQARCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 307
            G G  K T  C   C  RC+ +     C   C  CC +C CVPPG  GN +VC CY N  T  G  KCP
Sbjct:   39 GPGSLKRT-QCPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP 106          
The following BLAST results are available for this feature:
BLAST of CF504284 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SNAK2_SOLTU1.708e-3167.90Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1[more]
GASA1_ARATH4.650e-2970.73Gibberellin-regulated protein 1 OS=Arabidopsis tha... [more]
GASA3_ARATH3.449e-2465.75Gibberellin-regulated protein 3 OS=Arabidopsis tha... [more]
GASA2_ARATH3.449e-2460.49Gibberellin-regulated protein 2 OS=Arabidopsis tha... [more]
RSI1_SOLLC6.746e-1243.84Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=... [more]
GAST1_SOLLC1.151e-1145.07Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=... [more]
SNAK1_SOLTU2.563e-1142.37Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1[more]
GASA4_ARATH3.348e-1143.48Gibberellin-regulated protein 4 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-773 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_E08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504284 ID=CF504284|Name=CF504284|organism=Citrus sinensis|type=EST|length=391bp
AGCCATGGCCATCTCCAAAGCTCTTATTGCTTCAGTCCTCCTCTCACTAC
TTGTTTTTCATCTCGTTGAAGCTGATGAGCATACGGTTAACTCAAGCAAA
GGAACTGGTTATCCAAAACCAACAATTGACTGTGGAGGTGCATGCCAGGC
CAGGTGCCGATTATCGTCGAGGCCAAACCTGTGCCACAGGGCATGTGGTA
CCTGCTGCGCCCGTTGCAATTGTGTTCCTCCAGGCACTGCAGGCAACACT
GAGGTCTGCCCTTGCTACGCCAATATGACCACCCACCATGGCAGACGCAA
GTGCCCTTGAAGTATTTTAAGTTGAAAGGACGTCGTCTACTTTCTTAATT
AATTTTTTTGGAGCTTACATTCTCTCTTTCTCTCTATATAT
back to top