CF504285

Overview
NameCF504285
Unique NameCF504285
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length390
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12594 contig Csv1_Contig12594:72..460. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK2_SUASA (S-adenosylmethionine synthetase 2 OS=Suaeda salsa GN=METK2 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.631e-38
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKAN+DYEKIVRDTCRSIGF SADVGLDA
Sbjct:   17 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSADVGLDA 87          

HSP 2 Score: 33.113 bits (74), Expect = 3.631e-38
Identity = 14/15 (93.33%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            ME+FLFTSESVNEGH
Sbjct:    1 MESFLFTSESVNEGH 15          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK_LITCN (S-adenosylmethionine synthetase OS=Litchi chinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.029e-38
Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQVSDAVLDACLAQDPDSKVACETCT+TNMVMVFGEITTKANVDYE+IVRDTCRSIGFTS DVGLDA
Sbjct:   17 DKLCDQVSDAVLDACLAQDPDSKVACETCTRTNMVMVFGEITTKANVDYEQIVRDTCRSIGFTSDDVGLDA 87          

HSP 2 Score: 34.6538 bits (78), Expect = 8.029e-38
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            METFLFTSESVNEGH
Sbjct:    1 METFLFTSESVNEGH 15          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK_POPDE (S-adenosylmethionine synthetase OS=Populus deltoides GN=METK PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.046e-37
Identity = 68/71 (95.77%), Postives = 71/71 (100.00%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQ+SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFTSADVGLDA
Sbjct:   18 DKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDA 88          

HSP 2 Score: 32.7278 bits (73), Expect = 1.046e-37
Identity = 14/14 (100.00%), Postives = 14/14 (100.00%), Query Frame = 3
Query:  132 ETFLFTSESVNEGH 173
            ETFLFTSESVNEGH
Sbjct:    3 ETFLFTSESVNEGH 16          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK5_POPTR (S-adenosylmethionine synthetase 5 OS=Populus trichocarpa GN=METK5 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.046e-37
Identity = 68/71 (95.77%), Postives = 71/71 (100.00%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQ+SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFTSADVGLDA
Sbjct:   18 DKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDA 88          

HSP 2 Score: 32.7278 bits (73), Expect = 1.046e-37
Identity = 14/14 (100.00%), Postives = 14/14 (100.00%), Query Frame = 3
Query:  132 ETFLFTSESVNEGH 173
            ETFLFTSESVNEGH
Sbjct:    3 ETFLFTSESVNEGH 16          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK3_POPTR (S-adenosylmethionine synthetase 3 OS=Populus trichocarpa GN=METK3 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.046e-37
Identity = 68/71 (95.77%), Postives = 71/71 (100.00%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQ+SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFTSADVGLDA
Sbjct:   18 DKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDA 88          

HSP 2 Score: 32.7278 bits (73), Expect = 1.046e-37
Identity = 14/14 (100.00%), Postives = 14/14 (100.00%), Query Frame = 3
Query:  132 ETFLFTSESVNEGH 173
            ETFLFTSESVNEGH
Sbjct:    3 ETFLFTSESVNEGH 16          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK2_BETVU (S-adenosylmethionine synthetase 2 OS=Beta vulgaris GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.775e-37
Identity = 68/71 (95.77%), Postives = 69/71 (97.18%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQVSDAVLDACLAQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGFTS DVGLDA
Sbjct:   17 DKLCDQVSDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKAEVDYEKIVRDTCRSIGFTSDDVGLDA 87          

HSP 2 Score: 34.6538 bits (78), Expect = 1.775e-37
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            METFLFTSESVNEGH
Sbjct:    1 METFLFTSESVNEGH 15          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK4_POPTR (S-adenosylmethionine synthetase 4 OS=Populus trichocarpa GN=METK4 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.775e-37
Identity = 67/71 (94.37%), Postives = 70/71 (98.59%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQVSDA+LDACLAQDP+SKVACETC+KTNMVMVFGEITTKANVDYEKIVRDTCR IGFTSADVGLDA
Sbjct:   17 DKLCDQVSDAILDACLAQDPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSADVGLDA 87          

HSP 2 Score: 33.4982 bits (75), Expect = 1.775e-37
Identity = 14/15 (93.33%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            M+TFLFTSESVNEGH
Sbjct:    1 MDTFLFTSESVNEGH 15          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.310e-37
Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQ+SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCRSIGF S DVGLDA
Sbjct:   17 DKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDA 87          

HSP 2 Score: 34.6538 bits (78), Expect = 2.310e-37
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            METFLFTSESVNEGH
Sbjct:    1 METFLFTSESVNEGH 15          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.924e-37
Identity = 66/71 (92.96%), Postives = 69/71 (97.18%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQ+SDAVLDACLAQDPDSKVACETC+KTNMVMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDA
Sbjct:   17 DKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDA 87          

HSP 2 Score: 34.6538 bits (78), Expect = 3.924e-37
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            METFLFTSESVNEGH
Sbjct:    1 METFLFTSESVNEGH 15          
BLAST of CF504285 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.924e-37
Identity = 66/71 (92.96%), Postives = 69/71 (97.18%), Query Frame = 1
Query:  178 DKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDA 390
            DKLCDQ+SDAVLDACLAQDPDSKVACETC+KTNMVMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDA
Sbjct:   17 DKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDA 87          

HSP 2 Score: 34.6538 bits (78), Expect = 3.924e-37
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  129 METFLFTSESVNEGH 173
            METFLFTSESVNEGH
Sbjct:    1 METFLFTSESVNEGH 15          
The following BLAST results are available for this feature:
BLAST of CF504285 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_SUASA3.631e-3897.18S-adenosylmethionine synthetase 2 OS=Suaeda salsa ... [more]
METK_LITCN8.029e-3895.77S-adenosylmethionine synthetase OS=Litchi chinensi... [more]
METK_POPDE1.046e-3795.77S-adenosylmethionine synthetase OS=Populus deltoid... [more]
METK5_POPTR1.046e-3795.77S-adenosylmethionine synthetase 5 OS=Populus trich... [more]
METK3_POPTR1.046e-3795.77S-adenosylmethionine synthetase 3 OS=Populus trich... [more]
METK2_BETVU1.775e-3795.77S-adenosylmethionine synthetase 2 OS=Beta vulgaris... [more]
METK4_POPTR1.775e-3794.37S-adenosylmethionine synthetase 4 OS=Populus trich... [more]
METK_CARPA2.310e-3794.37S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK2_ELAUM3.924e-3792.96S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK1_ELAUM3.924e-3792.96S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-774 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_E09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504285 ID=CF504285|Name=CF504285|organism=Citrus sinensis|type=EST|length=390bp
CGTCTTTCTCTCGTTCTTCTGGGTACTTACCATTTTCGTATATCACCACC
TTCAATTCCATTTGTACTCGCACCACGGCCTCCTGCAAAGCGAAAGCTGC
AGCTTCAGGTTAAATCAAATTAAAGAAAATGGAAACATTTCTTTTCACAT
CAGAATCAGTGAACGAGGGTCACCTCGGACAAGCTGTGTGACCAAGTTTC
GGACGCAGTACTGGACGCGTGTTTGGCTCAGGATCCTGACAGCAAAGTTG
CTTGTGAAACATGCACAAAGACCAACATGGTCATGGTTTTTGGAGAAATT
ACAACCAAGGCCAATGTGGATTACGAGAAAATCGTGCGTGATACATGCAG
ATCGATTGGGTTCACATCGGCCGATGTGGGGCTTGATGCT
back to top