CF504286

Overview
NameCF504286
Unique NameCF504286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length233
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUM1_ARATH (Fumarate hydratase 1, mitochondrial OS=Arabidopsis thaliana GN=FUM1 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 2.851e-34
Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RSLQNF+IGGERERMPEPIVRAFG+LKKCAAKVNMEYGLDP IGKAIMQAAQEVAEGKLNDHFPLVVWQTG
Sbjct:   56 RSLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 126          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUM2_ARATH (Fumarate hydratase 2, chloroplastic OS=Arabidopsis thaliana GN=FUM2 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.377e-33
Identity = 65/71 (91.55%), Postives = 70/71 (98.59%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RSLQNF+IGG+RERMPEPIVRAFG+LKKCAAKVNMEYGLDP IG+AIM+AAQEVAEGKLNDHFPLVVWQTG
Sbjct:   63 RSLQNFEIGGDRERMPEPIVRAFGVLKKCAAKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTG 133          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_RHIOR (Fumarate hydratase, mitochondrial OS=Rhizopus oryzae GN=FUMR PE=3 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.086e-25
Identity = 53/71 (74.65%), Postives = 60/71 (84.51%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RSLQNFDIGG  ERMPEP++RAFG+LKK AA VNM YGLDP +G+AI +AA EV +G L DHFPLVVWQTG
Sbjct:   57 RSLQNFDIGGPTERMPEPLIRAFGVLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTG 127          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_RAT (Fumarate hydratase, mitochondrial OS=Rattus norvegicus GN=Fh PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.126e-25
Identity = 53/71 (74.65%), Postives = 59/71 (83.10%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RS  NF IGG  ERMP P+++AFGILK+ AA+VN EYGLDP I  AIM+AA EVAEGKLNDHFPLVVWQTG
Sbjct:   71 RSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQEYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTG 141          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_MOUSE (Fumarate hydratase, mitochondrial OS=Mus musculus GN=Fh PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 5.389e-25
Identity = 53/71 (74.65%), Postives = 59/71 (83.10%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RS  NF IGG  ERMP P+++AFGILK+ AA+VN EYGLDP I  AIM+AA EVAEGKLNDHFPLVVWQTG
Sbjct:   71 RSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQEYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTG 141          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_MACFA (Fumarate hydratase, mitochondrial OS=Macaca fascicularis GN=FH PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 7.038e-25
Identity = 52/71 (73.24%), Postives = 59/71 (83.10%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RS  NF IGG  ERMP P+++AFGILK+ AA+VN +YGLDP I  AIM+AA EVAEGKLNDHFPLVVWQTG
Sbjct:   74 RSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTG 144          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_HUMAN (Fumarate hydratase, mitochondrial OS=Homo sapiens GN=FH PE=1 SV=3)

HSP 1 Score: 112.464 bits (280), Expect = 7.038e-25
Identity = 52/71 (73.24%), Postives = 59/71 (83.10%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RS  NF IGG  ERMP P+++AFGILK+ AA+VN +YGLDP I  AIM+AA EVAEGKLNDHFPLVVWQTG
Sbjct:   74 RSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTG 144          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_PIG (Fumarate hydratase, mitochondrial OS=Sus scrofa GN=FH PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.048e-24
Identity = 52/71 (73.24%), Postives = 59/71 (83.10%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RS  NF IGG  ERMP P+++AFGILK+ AA+VN +YGLDP I  AIM+AA EVAEGKLNDHFPLVVWQTG
Sbjct:   30 RSTMNFKIGGVTERMPIPVLKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTG 100          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_SCHPO (Fumarate hydratase, mitochondrial OS=Schizosaccharomyces pombe GN=fum1 PE=2 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 1.917e-22
Identity = 49/71 (69.01%), Postives = 61/71 (85.92%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RSLQNF IGGE+ER+P P+VRAFG+LK+ AA VN E+GLDP +  AI QAAQEV +G+L+D+FPLVV+QTG
Sbjct:   82 RSLQNFRIGGEKERLPLPLVRAFGVLKRAAASVNREFGLDPKLADAIEQAAQEVIDGRLDDNFPLVVFQTG 152          
BLAST of CF504286 vs. ExPASy Swiss-Prot
Match: FUMH_DANRE (Fumarate hydratase, mitochondrial OS=Danio rerio GN=fh PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.503e-22
Identity = 50/71 (70.42%), Postives = 56/71 (78.87%), Query Frame = 1
Query:    1 RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTG 213
            RS  NF IGG  ERMP  ++RAFGILKK AA+VN +YGLDP I  AIM+AA EV  GKL+DHFPLVVWQTG
Sbjct:   73 RSTMNFRIGGVTERMPIQVIRAFGILKKAAAEVNKDYGLDPKIADAIMKAADEVESGKLDDHFPLVVWQTG 143          
The following BLAST results are available for this feature:
BLAST of CF504286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
FUM1_ARATH2.851e-3495.77Fumarate hydratase 1, mitochondrial OS=Arabidopsis... [more]
FUM2_ARATH5.377e-3391.55Fumarate hydratase 2, chloroplastic OS=Arabidopsis... [more]
FUMH_RHIOR1.086e-2574.65Fumarate hydratase, mitochondrial OS=Rhizopus oryz... [more]
FUMH_RAT4.126e-2574.65Fumarate hydratase, mitochondrial OS=Rattus norveg... [more]
FUMH_MOUSE5.389e-2574.65Fumarate hydratase, mitochondrial OS=Mus musculus ... [more]
FUMH_MACFA7.038e-2573.24Fumarate hydratase, mitochondrial OS=Macaca fascic... [more]
FUMH_HUMAN7.038e-2573.24Fumarate hydratase, mitochondrial OS=Homo sapiens ... [more]
FUMH_PIG2.048e-2473.24Fumarate hydratase, mitochondrial OS=Sus scrofa GN... [more]
FUMH_SCHPO1.917e-2269.01Fumarate hydratase, mitochondrial OS=Schizosacchar... [more]
FUMH_DANRE2.503e-2270.42Fumarate hydratase, mitochondrial OS=Danio rerio G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-775 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_E10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504286 ID=CF504286|Name=CF504286|organism=Citrus sinensis|type=EST|length=233bp
AGGTCGTTGCAGAACTTTGATATTGGCGGCGAGCGGGAGCGAATGCCCGA
ACCAATTGTTCGTGCCTTTGGCATCCTCAAGAAATGTGCTGCCAAGGTGA
ACATGGAGTATGGTCTTGATCCAGCCATAGGGAAAGCAATTATGCAAGCA
GCGCAAGAAGTAGCTGAGGGGAAGCTAAATGATCACTTTCCACTTGTTGT
CTGGCAAACTGGCAGGGCACTCAGAGTAATATG
back to top