CF504287

Overview
NameCF504287
Unique NameCF504287
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length345
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: TIR1B_ORYSJ (Transport inhibitor response 1-like protein Os04g0395600 OS=Oryza sativa subsp. japonica GN=Os04g0395600 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.526e-37
Identity = 70/104 (67.31%), Postives = 84/104 (80.77%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            VTEEG VAVS GC +L+ +LYFC QMTNAA+ T+ +NCPNFT FRLCI+ PG PD +T++P+DE FGA+V+ C  LQRLS+SGLLTD  F YIGKYAK LE LS
Sbjct:  354 VTEEGLVAVSLGCPKLNSLLYFCHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTSQPLDEGFGAIVRECKGLQRLSISGLLTDKVFMYIGKYAKQLEMLS 457          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: AFB2_ARATH (Protein AUXIN SIGNALING F-BOX 2 OS=Arabidopsis thaliana GN=AFB2 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.481e-35
Identity = 66/104 (63.46%), Postives = 82/104 (78.85%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            VTEEG VA+S GC +LH +LYFC+QMTNAA+ T+ +NCPNF  FRLCI+ P  PD++T++P+DE FGA+VK C  L+RLS+SGLLTD  F YIG YA  LE LS
Sbjct:  354 VTEEGLVAISAGCPKLHSILYFCQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLSGLLTDQVFLYIGMYANQLEMLS 457          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: TIR1_ARATH (Protein TRANSPORT INHIBITOR RESPONSE 1 OS=Arabidopsis thaliana GN=TIR1 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 3.089e-33
Identity = 67/104 (64.42%), Postives = 80/104 (76.92%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            +TE+G V+VS GC +L  VLYFCRQMTNAA+ TI +N PN T FRLCI+ P  PDYLT EP+D  FGA+V+ C  L+RLS+SGLLTD  FEYIG YAK +E LS
Sbjct:  359 LTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLS 462          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: AFB3_ARATH (Protein AUXIN SIGNALING F-BOX 3 OS=Arabidopsis thaliana GN=AFB3 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.533e-32
Identity = 64/111 (57.66%), Postives = 82/111 (73.87%), Query Frame = 2
Query:   11 DEEIIHGVTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            +E+    VTE G VA+S GC +LH +LYFC+QMTNAA+  + +NCPNF  FRLCI+ P  PD++T + +DE FGA+V+ C  L+RLSVSGLLTD  F YIG YA+ LE LS
Sbjct:  349 EEDNNASVTEVGLVAISAGCPKLHSILYFCKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVSGLLTDQVFLYIGMYAEQLEMLS 459          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: TIRC_ORYSJ (Transport inhibitor response 1-like protein Os11g0515500 OS=Oryza sativa subsp. japonica GN=Os11g0515500 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 9.937e-32
Identity = 60/104 (57.69%), Postives = 80/104 (76.92%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            VTEEG VA+S GC +L  VLYFC++MTN+A+ T+ +NCP FT FRLC++ PG  D +T +P+DE +GA+V++C  L+RL +SGLLTD  F YIG YA+ LE LS
Sbjct:  348 VTEEGLVAISAGCNKLQSVLYFCQRMTNSALITVAKNCPRFTSFRLCVLDPGSADAVTGQPLDEGYGAIVQSCKGLRRLCLSGLLTDTVFLYIGMYAERLEMLS 451          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: TIR1L_ARATH (Transport inhibitor response 1-like protein OS=Arabidopsis thaliana GN=At5g49980 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.197e-30
Identity = 61/104 (58.65%), Postives = 77/104 (74.04%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            V+E G  A+S GCR+L  +LYFC++MTNAAV  + +NCP  T FRLCIM    PD++T +PMDE FGA+VK C KL RL+VSGLLTD  F Y+G+Y K + TLS
Sbjct:  405 VSELGLQAISEGCRKLESILYFCQRMTNAAVIAMSENCPELTVFRLCIMGRHRPDHVTGKPMDEGFGAIVKNCKKLTRLAVSGLLTDQAFRYMGEYGKLVRTLS 508          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: FBX14_ARATH (F-box protein FBX14 OS=Arabidopsis thaliana GN=FBX14 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.616e-29
Identity = 59/104 (56.73%), Postives = 74/104 (71.15%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            V+  G  A+S GCR+L  +LYFC+ MTN AV  + +NCP  T FRLCIM    PD++T +PMD+ FGA+VK C KL RL+VSGLLTD  F YIG+Y K + TLS
Sbjct:  405 VSGVGLQAISEGCRKLESILYFCQNMTNGAVTAMSENCPQLTVFRLCIMGRHRPDHVTGKPMDDGFGAIVKNCKKLTRLAVSGLLTDEAFSYIGEYGKLIRTLS 508          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: TIR1A_ORYSJ (Transport inhibitor response 1-like protein Os05g0150500 OS=Oryza sativa subsp. japonica GN=Os05g0150500 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.029e-29
Identity = 61/104 (58.65%), Postives = 75/104 (72.12%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            +TE G V VS  C  L  VLYFCR+MTN A+ TI +N PNFT FRLCI+ P  PDY+T EP+D  F A+V++C  L+RLS+SGLLTDL F+ IG +A  LE LS
Sbjct:  370 LTERGLVDVSASCPMLESVLYFCRRMTNEALITIAKNRPNFTCFRLCILEPHTPDYITREPLDAGFSAIVESCRGLRRLSISGLLTDLVFKSIGAHADRLEMLS 473          
BLAST of CF504287 vs. ExPASy Swiss-Prot
Match: GRH1_ARATH (GRR1-like protein 1 OS=Arabidopsis thaliana GN=GRH1 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.665e-28
Identity = 59/104 (56.73%), Postives = 75/104 (72.12%), Query Frame = 2
Query:   32 VTEEGFVAVSFGCRRLHYVLYFCRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVSGLLTDLTFEYIGKYAKNLETLS 343
            +TE+G V VS GCR+L  VLYFC Q TNAA+ TI +  PN   FRLC++ P  PDY TNEP+D+ F A+ + C  L+RLSVSGLL+D  F+YIGK+AK +  LS
Sbjct:  355 LTEQGLVFVSKGCRKLESVLYFCVQFTNAALFTIARKRPNLKCFRLCVIEPFAPDYKTNEPLDKGFKAIAEGCRDLRRLSVSGLLSDKAFKYIGKHAKKVRMLS 458          
The following BLAST results are available for this feature:
BLAST of CF504287 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
TIR1B_ORYSJ3.526e-3767.31Transport inhibitor response 1-like protein Os04g0... [more]
AFB2_ARATH1.481e-3563.46Protein AUXIN SIGNALING F-BOX 2 OS=Arabidopsis tha... [more]
TIR1_ARATH3.089e-3364.42Protein TRANSPORT INHIBITOR RESPONSE 1 OS=Arabidop... [more]
AFB3_ARATH1.533e-3257.66Protein AUXIN SIGNALING F-BOX 3 OS=Arabidopsis tha... [more]
TIRC_ORYSJ9.937e-3257.69Transport inhibitor response 1-like protein Os11g0... [more]
TIR1L_ARATH3.197e-3058.65Transport inhibitor response 1-like protein OS=Ara... [more]
FBX14_ARATH4.616e-2956.73F-box protein FBX14 OS=Arabidopsis thaliana GN=FBX... [more]
TIR1A_ORYSJ6.029e-2958.65Transport inhibitor response 1-like protein Os05g0... [more]
GRH1_ARATH6.665e-2856.73GRR1-like protein 1 OS=Arabidopsis thaliana GN=GRH... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-776 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_E11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504287 ID=CF504287|Name=CF504287|organism=Citrus sinensis|type=EST|length=345bp
GGATTCCTTTGACGAGGAAATCATCCATGGGGTTACTGAAGAAGGGTTTG
TTGCTGTTTCTTTTGGCTGTCGGAGACTCCACTATGTTCTTTACTTTTGT
CGGCAGATGACCAATGCTGCTGTGGCAACAATTGTGCAGAATTGCCCCAA
TTTCACCCACTTCCGTCTCTGCATAATGACTCCAGGACTACCTGATTACC
TGACCAATGAACCCATGGATGAGGCTTTTGGTGCAGTGGTGAAGACTTGC
AGTAAACTCCAACGACTTTCAGTTTCAGGTCTCTTAACTGACCTGACATT
TGAGTACATTGGAAAGTATGCCAAAAATTTGGAAACCCTTTCAGT
back to top