CF504289

Overview
NameCF504289
Unique NameCF504289
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length540
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1476 contig Csv1_Contig1476:60..599. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E13L3_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 3 OS=Arabidopsis thaliana GN=At5g08000 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 7.052e-34
Identity = 58/89 (65.17%), Postives = 74/89 (83.15%), Query Frame = 2
Query:  146 HSTANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            H++A+WCVCK G+ D VLQK LDYACG GADCNP H  G C+NP+ V+AHC+YAVNS+FQ+KGQA  SC+F+G+AT+ TTDPS  GC++
Sbjct:   16 HTSASWCVCKTGLSDSVLQKTLDYACGNGADCNPTHPKGSCFNPDNVRAHCNYAVNSFFQKKGQASESCNFTGTATLTTTDPSYTGCAF 104          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E13L2_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 2 OS=Arabidopsis thaliana GN=At5g61130 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.622e-30
Identity = 53/89 (59.55%), Postives = 69/89 (77.53%), Query Frame = 2
Query:  146 HSTANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            HS+A+WCVCK G+ D VLQ  LDYACG GADCNP      C+NP+ V++HC+YAVNS+FQ+KGQ+ GSC+F G+AT   +DPS  GC++
Sbjct:   16 HSSASWCVCKTGLSDTVLQATLDYACGNGADCNPTKPKQSCFNPDNVRSHCNYAVNSFFQKKGQSPGSCNFDGTATPTNSDPSYTGCAF 104          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E13L4_ARATH (Glucan endo-1,3-beta-glucosidase-like protein At1g69295 OS=Arabidopsis thaliana GN=At1g69295 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.878e-24
Identity = 49/85 (57.65%), Postives = 63/85 (74.12%), Query Frame = 2
Query:  146 HSTANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTA 400
            +S A +C+CK+G  + VLQKA+DYACG GADC  I   G CY PNTVK HC  AVNSY+Q+K  +  +CDF+G+A+ +TT PSTA
Sbjct:   16 YSNAAYCLCKEG-NEQVLQKAIDYACGNGADCTQIQPTGACYQPNTVKNHCDVAVNSYYQKKASSGATCDFNGAASPSTTPPSTA 99          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 2.602e-20
Identity = 43/85 (50.59%), Postives = 56/85 (65.88%), Query Frame = 2
Query:  161 WCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            +C+  DGV    LQ ALD+ACG G ++C+ I     CY PN VK H S+A NSY+Q++G+A GSCDF G A + TTDPS   C +
Sbjct:  272 YCIAMDGVDAKTLQAALDWACGPGRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIF 356          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.796e-20
Identity = 40/84 (47.62%), Postives = 54/84 (64.29%), Query Frame = 2
Query:  161 WCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            WCV KDG     LQ  ++YACG   DC PI S G C++PN+++AH SY +N+Y+Q  G    +CDF G+  V ++DPS  GC Y
Sbjct:  377 WCVAKDGANGTDLQNNINYACGF-VDCKPIQSGGACFSPNSLQAHASYVMNAYYQANGHTDLACDFKGTGIVTSSDPSYGGCKY 459          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 8.369e-19
Identity = 42/85 (49.41%), Postives = 56/85 (65.88%), Query Frame = 2
Query:  161 WCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            +C+ K+ V   +LQ ALD+ACG G  DC+ +     CY P+ V AH +YA N+Y+Q+ G+A GSCDF G ATV TTDPS   C +
Sbjct:  360 FCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVF 444          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 5.425e-18
Identity = 39/88 (44.32%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  149 STANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            +++ WCV K G  +  LQ +LD+ACG G DC  I   G C+ PN V +H +YA+N YFQ+  +    CDFS +ATV + +PS   C Y
Sbjct:  360 TSSGWCVPKKGATNEELQASLDWACGHGIDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNNCVY 447          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 8.660e-16
Identity = 39/90 (43.33%), Postives = 53/90 (58.89%), Query Frame = 2
Query:  146 HSTANWCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            + ++ +CV K    D  L   L++ACG G A+C  I    PCY PN VK+H S+A N Y+Q+   A G+CDF G+A   T DPS   C+Y
Sbjct:  357 NGSSMFCVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAY 446          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E132_ARATH (Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis thaliana GN=At1g66250 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.131e-15
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  161 WCVCKDGVGDPVLQKALDYACGAGA-DCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            +C  ++G    +LQ ALD+ACG G  DC+PI     CY P+ V AH +YA ++Y+ + G    +C+F+G A++ TTDPS   C +
Sbjct:  368 YCTAREGADTKMLQAALDWACGPGKIDCSPIKQGETCYEPDNVVAHANYAFDTYYHQTGNNPDACNFNGVASITTTDPSHGTCVF 452          
BLAST of CF504289 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.477e-15
Identity = 35/88 (39.77%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  152 TANWCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGCSY 412
            T  WC+         LQ ALD+ACG G  DC+ +  + PC+ P+TV +H SYA N+Y+Q+ G +   C F+G++     DPS   C Y
Sbjct:  388 TKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLY 475          
The following BLAST results are available for this feature:
BLAST of CF504289 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
E13L3_ARATH7.052e-3465.17Glucan endo-1,3-beta-glucosidase-like protein 3 OS... [more]
E13L2_ARATH3.622e-3059.55Glucan endo-1,3-beta-glucosidase-like protein 2 OS... [more]
E13L4_ARATH3.878e-2457.65Glucan endo-1,3-beta-glucosidase-like protein At1g... [more]
E131_ARATH2.602e-2050.59Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E13B_WHEAT5.796e-2047.62Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E133_ARATH8.369e-1949.41Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E137_ARATH5.425e-1844.32Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E134_ARATH8.660e-1643.33Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis ... [more]
E132_ARATH1.131e-1541.18Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis ... [more]
E1312_ARATH1.477e-1539.77Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-778 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_F01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504289 ID=CF504289|Name=CF504289|organism=Citrus sinensis|type=EST|length=540bp
CTTAGCTGCTGTGTGTGTTGTGACAAACTTTTCTCGGAGCCAAACAAGCA
AGTATTTGTTATTATTATCTCTTCTCTAAGCTTCTTTTGCTCATTCAGTG
ATGGCTGTTTTGGTGCTTTTAGCTCTCTTCCTTGGCTTCACTGGGCATTC
AACTGCAAACTGGTGTGTTTGCAAAGATGGAGTGGGTGACCCAGTTTTAC
AAAAAGCTTTGGACTATGCTTGTGGAGCTGGGGCTGATTGTAACCCTATC
CATTCCAATGGGCCTTGTTACAACCCCAACACTGTCAAAGCTCACTGCAG
TTATGCTGTCAACAGCTATTTCCAGAGAAAGGGTCAAGCTCAAGGCTCTT
GTGATTTTTCCGGAAGTGCAACCGTTGCCACTACCGATCCCAGCACTGCT
GGCTGTTCTTATCCTTCAAGTGCCAGCACTTCAGGCACCACCTCAACAAC
ACCAGTCACAGGTACTCCAGGCACAACCACACCCACAACAACTCCGTCCA
CTACCACTCCAACGACTAACACACCAGGCAGCACCACACC
back to top