CF504295

Overview
NameCF504295
Unique NameCF504295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length248
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF504295_ssr72 microsatellite CF504295_ssr72:72..83. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4194 contig Csv1_Contig4194:6..253. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS17_SOLLC (40S ribosomal protein S17 OS=Solanum lycopersicum GN=RPS17 PE=2 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.034e-20
Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKKSSRQVIERYYS+MTLDFHTNKKILEEVAIIPSKRLRNKI
Sbjct:    1 MGRVRTKTVKKSSRQVIERYYSKMTLDFHTNKKILEEVAIIPSKRLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS174_ARATH (40S ribosomal protein S17-4 OS=Arabidopsis thaliana GN=RPS17D PE=2 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.034e-20
Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKKSSRQVIE+YYSRMTLDFHTNKKILEEVAIIPSKRLRNKI
Sbjct:    1 MGRVRTKTVKKSSRQVIEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS173_ARATH (40S ribosomal protein S17-3 OS=Arabidopsis thaliana GN=RPS17C PE=2 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.034e-20
Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKKSSRQVIE+YYSRMTLDFHTNKKILEEVAIIPSKRLRNKI
Sbjct:    1 MGRVRTKTVKKSSRQVIEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS172_ARATH (40S ribosomal protein S17-2 OS=Arabidopsis thaliana GN=RPS17B PE=2 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.034e-20
Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKKSSRQVIE+YYSRMTLDFHTNKKILEEVAIIPSKRLRNKI
Sbjct:    1 MGRVRTKTVKKSSRQVIEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS171_ARATH (40S ribosomal protein S17-1 OS=Arabidopsis thaliana GN=RPS17A PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.034e-20
Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKKSSRQVIE+YYSRMTLDFHTNKKILEEVAIIPSKRLRNKI
Sbjct:    1 MGRVRTKTVKKSSRQVIEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS17_DROME (40S ribosomal protein S17 OS=Drosophila melanogaster GN=RpS17 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 5.874e-16
Identity = 38/50 (76.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKK+++ +IE+YY+R+TLDFHTNK+I EEVAIIP+K LRNKI
Sbjct:    1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS17_BOVIN (40S ribosomal protein S17 OS=Bos taurus GN=RPS17 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.232e-15
Identity = 36/50 (72.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKK++R +IE+YY+R+  DFHTNK++ EE+AIIPSK+LRNKI
Sbjct:    1 MGRVRTKTVKKAARVIIEKYYTRLDNDFHTNKRVCEEIAIIPSKKLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS17_PIG (40S ribosomal protein S17 OS=Sus scrofa GN=RPS17 PE=2 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 2.915e-15
Identity = 36/50 (72.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKK++R +IE+YY+R+  DFHTNK++ EE+AIIPSK+LRNKI
Sbjct:    1 MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS17_MOUSE (40S ribosomal protein S17 OS=Mus musculus GN=Rps17 PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 2.915e-15
Identity = 36/50 (72.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKK++R +IE+YY+R+  DFHTNK++ EE+AIIPSK+LRNKI
Sbjct:    1 MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKI 50          
BLAST of CF504295 vs. ExPASy Swiss-Prot
Match: RS17_ICTPU (40S ribosomal protein S17 OS=Ictalurus punctatus GN=rps17 PE=2 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 2.915e-15
Identity = 36/50 (72.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:   98 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKI 247
            MGRVRTKTVKK++R +IE+YY+R+  DFHTNK++ EE+AIIPSK+LRNKI
Sbjct:    1 MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKI 50          
The following BLAST results are available for this feature:
BLAST of CF504295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
RS17_SOLLC1.034e-2098.0040S ribosomal protein S17 OS=Solanum lycopersicum ... [more]
RS174_ARATH1.034e-2098.0040S ribosomal protein S17-4 OS=Arabidopsis thalian... [more]
RS173_ARATH1.034e-2098.0040S ribosomal protein S17-3 OS=Arabidopsis thalian... [more]
RS172_ARATH1.034e-2098.0040S ribosomal protein S17-2 OS=Arabidopsis thalian... [more]
RS171_ARATH1.034e-2098.0040S ribosomal protein S17-1 OS=Arabidopsis thalian... [more]
RS17_DROME5.874e-1676.0040S ribosomal protein S17 OS=Drosophila melanogast... [more]
RS17_BOVIN2.232e-1572.0040S ribosomal protein S17 OS=Bos taurus GN=RPS17 P... [more]
RS17_PIG2.915e-1572.0040S ribosomal protein S17 OS=Sus scrofa GN=RPS17 P... [more]
RS17_MOUSE2.915e-1572.0040S ribosomal protein S17 OS=Mus musculus GN=Rps17... [more]
RS17_ICTPU2.915e-1572.0040S ribosomal protein S17 OS=Ictalurus punctatus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-784 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_F07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504295 ID=CF504295|Name=CF504295|organism=Citrus sinensis|type=EST|length=248bp
CTTCGCTTTAGCTGCCGCAATCTCTTGACATCTCAAGCTCTTCTGCTTCA
CCGTCTTTGTCTTCTTCAAGACAGCAGCAGCAGCTTCTTAAACTGAAATG
GGTCGTGTTCGTACCAAGACCGTGAAGAAGTCCTCTCGCCAGGTGATTGA
GAGGTACTACTCAAGAATGACACTGGACTTCCATACCAACAAGAAGATTT
TGGAGGAGGTTGCTATCATCCCCTCGAAGAGGCTGCGTAACAAAATTG
back to top