CF504301

Overview
NameCF504301
Unique NameCF504301
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length460
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF504301_ssr228 microsatellite CF504301_ssr228:228..251. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig534 contig Csv1_Contig534:1..465. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: FB95_ARATH (F-box protein At2g02240 OS=Arabidopsis thaliana GN=At2g02240 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 3.689e-31
Identity = 63/122 (51.64%), Postives = 82/122 (67.21%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPE 443
            P+  +   ISFT+PRDAC  +SVS  F+SA  SD VW+ FLPP+Y                   KKELYF+LCHNP+LI++GKKSF L+K SGK+C M+S+++L I W S+  YW+WISIPE
Sbjct:   65 PEDCISNIISFTSPRDACVAASVSKTFESAVSSDCVWDKFLPPEYESLVSRSRVFAS-------KKELYFALCHNPVLIEDGKKSFWLEKASGKRCIMLSSKELWITWGSSPEYWQWISIPE 179          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: PP2B2_ARATH (Putative F-box protein PP2-B2 OS=Arabidopsis thaliana GN=PP2B2 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.986e-28
Identity = 60/123 (48.78%), Postives = 80/123 (65.04%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMIS-ARDLLIIWSSTSAYWRWISIPE 443
            P+  +   ISFT+PRDAC  +SVS  F+SA  SD+VW+ FLP DY                   KKELYF++C NP+L+++G KSF L+K++GKKC+M+S  + + I W ST  YWRWISIPE
Sbjct:   46 PEDCISNIISFTSPRDACVAASVSKTFESAVNSDSVWDKFLPSDYSSLVPPSRVFSS-------KKELYFAICDNPVLVEDGGKSFWLEKENGKKCFMLSPKKSMWITWVSTPQYWRWISIPE 161          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: PP2B1_ARATH (F-box protein PP2-B1 OS=Arabidopsis thaliana GN=PP2B1 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.895e-27
Identity = 59/130 (45.38%), Postives = 81/130 (62.31%), Query Frame = 3
Query:   54 RKQKWSFYPKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPE 443
            R  ++   P+  +   IS T+PRDAC ++SVS   KSAA+SD VWE FLP +Y                   KKE++ SL  N +L++ GKKSF ++K SGKKCYM+SA +L IIW  + AYW+WI++PE
Sbjct:   28 RASRFDALPEDCISKVISHTSPRDACVVASVSKSVKSAAQSDLVWEMFLPSEYSSLVLQSANHLS-------KKEIFLSLADNSVLVENGKKSFWVEKASGKKCYMLSAMELTIIWGDSPAYWKWITVPE 150          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: P2B10_ARATH (F-box protein PP2-B10 OS=Arabidopsis thaliana GN=PP2B10 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.403e-27
Identity = 58/123 (47.15%), Postives = 75/123 (60.98%), Query Frame = 3
Query:   75 YPKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPE 443
            +P+  +   ISFT PRDAC  ++VS  F+S  +SD +WE FLP DY                   KKELYFSLC++P+L D+ KKS  L+K SGK+C M+SA +L IIW     YW+WI IPE
Sbjct:   17 FPEDCISYIISFTNPRDACVAATVSKTFESTVKSDIIWEKFLPADYESLIPPSRVFSS-------KKELYFSLCNDPVLFDDDKKSVWLEKASGKRCLMLSAMNLSIIWGDNPQYWQWIPIPE 132          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: P2B12_ARATH (Putative F-box protein PP2-B12 OS=Arabidopsis thaliana GN=PP2B12 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.025e-25
Identity = 52/122 (42.62%), Postives = 78/122 (63.93%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPE 443
            P+  + T ISFT+P DACR+S+VS + +SAA+S+  WE FLP DY                    K+L+   C +P+LI++G+ SF ++K+SGKKC+M+SAR L I+W  +  +W W+SIP+
Sbjct:    7 PEECIATMISFTSPFDACRISAVSKLLRSAADSNTTWERFLPSDYRMYIDNSLSRFS-------NKQLFLRFCESPLLIEDGRTSFWMEKRSGKKCWMLSARKLDIVWVDSPEFWIWVSIPD 121          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: PP2B8_ARATH (Putative F-box protein PP2-B8 OS=Arabidopsis thaliana GN=PP2B8 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.561e-24
Identity = 54/122 (44.26%), Postives = 74/122 (60.66%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPE 443
            P+  +   +SFT+P+DAC L+SVS  F SA +SD VWE F+PP+Y                   KKELYF+LC   +LID+GKKS  ++K + K+C MISA +L I W ++   WRWI  P+
Sbjct:   40 PEECVSIIVSFTSPQDACVLASVSKTFASAVKSDIVWEKFIPPEYESLISQSRAFKFLS-----KKELYFALCDKSVLIDDGKKSLWIEKANAKRCIMISAMNLAIAWGNSPQSWRWIPDPQ 156          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: P2B11_ARATH (F-box protein PP2-B11 OS=Arabidopsis thaliana GN=PP2B11 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.561e-24
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPEVSGG 455
            P+  +   +S TTP D CRLS+VS+IF+SAA SD VW  FLP D+                   +K+L+FSL  NP+LI+    SFSL+++SG KCYM++AR L I+W     YW WIS+P    G
Sbjct:    5 PEDCIAKILSLTTPLDVCRLSAVSSIFRSAAGSDDVWNHFLPADFPAGFAAPAGLPT-------RKQLFFSLVDNPLLINGTLLSFSLERKSGNKCYMMAARALNIVWGHEQRYWHWISLPNTRFG 123          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: PP2B6_ARATH (Putative F-box protein PP2-B6 OS=Arabidopsis thaliana GN=PP2B6 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.076e-22
Identity = 50/124 (40.32%), Postives = 75/124 (60.48%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAYWRWISIPEVS 449
            P+  +   ISFT+PRD C  +SVS  F  A + D++WE FLP +Y                   KK+LYF+LC++P+L+++GKKSF L+  SGKKC +++A++L I   +   YW+WI + E S
Sbjct:   49 PEDCISNIISFTSPRDVCVSASVSKSFAHAVQCDSIWEKFLPSEYESLIPPWRVFSS-------KKDLYFTLCYDPVLVEDGKKSFWLETASGKKCVLLAAKELWITGGNNPEYWQWIELCESS 165          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: PP2B3_ARATH (F-box protein PP2-B3 OS=Arabidopsis thaliana GN=PP2B3 PE=2 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 1.190e-21
Identity = 54/114 (47.37%), Postives = 70/114 (61.40%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDLLIIWSSTSAY 419
            P+  +   ISFTTPRDAC  +SVS  F+SA +SD+VWE FLP DY                   KKEL FSLC  P+LI+ GKKSF LDK SG+KC M+S + ++I W ++  +
Sbjct:   17 PENCISNIISFTTPRDACFAASVSKAFESAVQSDSVWEKFLPLDYSSLVPESRVFLS-------KKELCFSLCRVPLLIEGGKKSFWLDKTSGEKCIMLSPKGMVISWVNSPQF 123          
BLAST of CF504301 vs. ExPASy Swiss-Prot
Match: SKIP3_ARATH (F-box protein SKIP3 OS=Arabidopsis thaliana GN=SKIP3 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 7.658e-21
Identity = 55/123 (44.72%), Postives = 73/123 (59.35%), Query Frame = 3
Query:   78 PKVALPTPISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYXXXXXXXXXXXXXXXXXXXKKELYFSLCHNPILIDEGKKSFSLDKQSGKKCYMISARDL-LIIWSSTSAYWRWISIPE 443
            P+  +   ISFT+P DAC  ++VS IF+SA +SD VWE FLP DY                   KKELYFSLC++P+LI++GK S  L+K SGK+C M+SA  + L   +  S  + WI  PE
Sbjct:   28 PEGCISNIISFTSPEDACVAAAVSKIFESAVKSDIVWEKFLPTDYESLITPSRVFSS-------KKELYFSLCNDPLLIEDGKMSLWLEKASGKRCIMLSATAMNLSSMADMSQRFLWIPCPE 143          

HSP 2 Score: 21.557 bits (44), Expect = 7.658e-21
Identity = 7/11 (63.64%), Postives = 10/11 (90.91%), Query Frame = 2
Query:   65 MELLPEGCIAN 97
            ++ LPEGCI+N
Sbjct:   24 LDSLPEGCISN 34          
The following BLAST results are available for this feature:
BLAST of CF504301 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
FB95_ARATH3.689e-3151.64F-box protein At2g02240 OS=Arabidopsis thaliana GN... [more]
PP2B2_ARATH4.986e-2848.78Putative F-box protein PP2-B2 OS=Arabidopsis thali... [more]
PP2B1_ARATH1.895e-2745.38F-box protein PP2-B1 OS=Arabidopsis thaliana GN=PP... [more]
P2B10_ARATH9.403e-2747.15F-box protein PP2-B10 OS=Arabidopsis thaliana GN=P... [more]
P2B12_ARATH3.025e-2542.62Putative F-box protein PP2-B12 OS=Arabidopsis thal... [more]
PP2B8_ARATH2.561e-2444.26Putative F-box protein PP2-B8 OS=Arabidopsis thali... [more]
P2B11_ARATH2.561e-2444.44F-box protein PP2-B11 OS=Arabidopsis thaliana GN=P... [more]
PP2B6_ARATH1.076e-2240.32Putative F-box protein PP2-B6 OS=Arabidopsis thali... [more]
PP2B3_ARATH1.190e-2147.37F-box protein PP2-B3 OS=Arabidopsis thaliana GN=PP... [more]
SKIP3_ARATH7.658e-2144.72F-box protein SKIP3 OS=Arabidopsis thaliana GN=SKI... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-790 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_G01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504301 ID=CF504301|Name=CF504301|organism=Citrus sinensis|type=EST|length=460bp
CCTCGTGCCGCGTCTGCGCATCTGTCTCTCCATCTCCCTTTTTCTAATTT
CCACGGAAGCAGAAATGGAGCTTTTACCCGAAGGTTGCATTGCCAACGCC
TATTTCCTTTACTACTCCTCGTGACGCATGCAGATTGTCTTCAGTTTCAA
CTATCTTCAAGTCGGCGGCCGAATCCGACGCCGTTTGGGAGAGCTTTTTG
CCGCCCGATTACTCTACTCTTCTTTCGTCTTCTTCTTCTTCTTCTTCTTC
TTCGCTGCGTTCCTCCTCTAAGAAGGAGCTCTATTTTAGCCTCTGTCATA
ACCCTATCCTCATCGACGAGGGCAAAAAGAGCTTTTCACTGGACAAGCAG
AGTGGGAAGAAATGTTACATGATATCCGCTAGGGATCTTCTGATTATCTG
GAGCTCTACATCTGCTTATTGGAGATGGATCTCTATTCCTGAGGTTTCTG
GAGGTGGCTG
back to top