CF831914

Overview
NameCF831914
Unique NameCF831914
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length778
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF831914 vs. ExPASy Swiss-Prot
Match: SKI22_ARATH (F-box protein SKIP22 OS=Arabidopsis thaliana GN=SKIP22 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 9.049e-28
Identity = 81/203 (39.90%), Postives = 102/203 (50.25%), Query Frame = -2
Query:  208 KEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGG--PADAQGKTNWKERFVFNWEYNR--------------KRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRN----FAPNCNLGG 756
            +EVF FW+ VKD L +PLLI +CDKAGL  P C   LPTELKLK+LE LPGV +  M CV  +MRYLAS+N+LW+QK +EE       +A    NWK RF   W   +               R+ + T      + R    II DPP  +     + G       +I   P   GQ  +     +GRR     F P CNLGG
Sbjct:  289 REVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNFVVTEAGDSVNWKARFATFWRQKQLAAASDTFWRQNQLGRRNISTGRSGIRFPR----IIGDPPFTWFNGDRMHG-------SIGIHP---GQSAR----GLGRRTWGQLFTPRCNLGG 473          
BLAST of CF831914 vs. ExPASy Swiss-Prot
Match: FB17_ARATH (Putative F-box protein At1g23770 OS=Arabidopsis thaliana GN=At1g23770 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.490e-25
Identity = 76/177 (42.94%), Postives = 92/177 (51.98%), Query Frame = -2
Query:  253 KEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADA--QGKTNWKERFVFNWEYNRKRKRVITPA---PWFPYTRPYFPII----RDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPP 756
            +EVF  W+ VKD L +PLLI LCDKAGL  P C   LPTELKLK+LE LPGV +  M CV  +MRYLAS+N+LW  K +EE  G       G  +WK +F   W    +RKR+   A   P    + P FP +    RD   PF           DR+    F  F L   R  F P
Sbjct:  176 REVFMLWRMVKDELVIPLLIGLCDKAGLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLEEGKGCLWKLYTGDVDWKRKFASFW----RRKRLDLLARRNPPIKKSNPRFPTLFPDRRDRREPF-----------DRFGPSDFYRFGLRDPRDRFGP 337          
BLAST of CF831914 vs. ExPASy Swiss-Prot
Match: FB81_ARATH (F-box protein At1g70360 OS=Arabidopsis thaliana GN=At1g70360 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.312e-15
Identity = 39/74 (52.70%), Postives = 52/74 (70.27%), Query Frame = -2
Query:  550 SFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLAS 771
            S DC  +V  +W+ +KDG+  PLL+DLC K GL LP C+  LP ELK K+LE LPGVD+  + CVS ++R +AS
Sbjct:  103 SIDC--KVLVWWRMIKDGIVTPLLVDLCYKTGLELPPCFISLPRELKHKILESLPGVDIGTLACVSSELRDMAS 174          
The following BLAST results are available for this feature:
BLAST of CF831914 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SKI22_ARATH9.049e-2839.90F-box protein SKIP22 OS=Arabidopsis thaliana GN=SK... [more]
FB17_ARATH5.490e-2542.94Putative F-box protein At1g23770 OS=Arabidopsis th... [more]
FB81_ARATH2.312e-1552.70F-box protein At1g70360 OS=Arabidopsis thaliana GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A02_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831914 ID=CF831914|Name=CF831914|organism=Citrus sinensis|type=EST|length=778bp
GTAACTTAGGGGCCATTAAAGGCCTCAAAAAGACATTAAAAAAAAAACAA
ATCGACTCCCTACTCATATATACATAGATTATTTAACAGAGATATTTAAC
ATCTGCTTATACATAGGTTATTTAACATAGATATTTAACATCTGCTTAAG
ATACCTCCAACAAATCTTGATTTCATCACTCTGTGCCAACCCAGAGGATC
TTCAAGTCCCTCCTAAGTTACAGTTAGGAGCAAAATTCCGCCGTCCAATG
CAGGGAGGAAACACTTGACGGCGCTGTCCTAGAGGAAAAGGGGGAAAATG
GATGTTAGGGTACCGGTCATAATCACCACCTTGTATGAGAGAATTTCCAC
CAAATGGAGCAGGAGGATCTCTTATAATTGGAAAATAAGGCCTGGTATAA
GGAAACCAGGGTGCTGGTGTGATTACCCTCTTTCTTTTCCTGTTGTACTC
CCAATTAAAAACAAACCTTTCTTTCCAATTGGTTTTTCCTTGTGCATCCG
CTGGACCTCCGAACTCCTCCACAAATTTTTGCCTCCATAATTCATTATTC
GAAGCCAAATATCGCATATCCCTAGAAACACATTCCATTTTTGCAACATC
AACACCAGGAAGACACTCCAAAAGCTTAAGCTTAAGCTCTGTTGGGAGAT
GCGTCCAACACGCTGGAAGACACAAGCCAGCCTTATCACAAAGATCAATC
AATAATGGTAATGCAAGCCCATCCTTCACATTCTTCCAAAATTCAAACAC
TTCTTTTCCACAATCAAAACTCTTATAC
back to top