CF831916

Overview
NameCF831916
Unique NameCF831916
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length801
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5402 contig Csv1_Contig5402:247..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF1_ARATH (Glutathione S-transferase 1 OS=Arabidopsis thaliana GN=GST1 PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 2.566e-49
Identity = 99/148 (66.89%), Postives = 112/148 (75.68%), Query Frame = -2
Query:  354 GDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 797
            GD K+FESRAITQYIA EF DKG  L   GK +A + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D FTLVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:   61 GDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAQKVL 208          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF_HYOMU (Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.172e-48
Identity = 96/149 (64.43%), Postives = 112/149 (75.17%), Query Frame = -2
Query:  354 GDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 797
            GD KLFESRAITQYIA  + DKG QL     K +A + VW EVE+ +FDP +SKL +E+V KPM GM TD AAV ENE KL K+LDVYE+RL  SKYL  DSFTL DLHH P +N L+GT VK LFD+RPHVSAW ADI +RPAW+K +
Sbjct:   60 GDLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTKVKSLFDSRPHVSAWCADILARPAWSKAI 208          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GST11_ARATH (Glutathione S-transferase 11 OS=Arabidopsis thaliana GN=GST11 PE=1 SV=3)

HSP 1 Score: 191.045 bits (484), Expect = 6.320e-48
Identity = 100/149 (67.11%), Postives = 112/149 (75.17%), Query Frame = -2
Query:  354 GDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 797
            GD KLFESRAITQYIA  + DKG QL   G K IA + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D FTLVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:   61 GDFKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAKKVL 209          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF1_TOBAC (Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.655e-46
Identity = 91/153 (59.48%), Postives = 116/153 (75.82%), Query Frame = -2
Query:  342 GDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 797
            GD KLFESRAITQYIA  + D G QL     K +  + VW EVE  +F+PP++KL WEL  KP+ GMTTD AAV+E+EA+L+K+LD+YE +L++SKYL  DSFTLVDLHH+PNI  L+ + VK++FD+RP VSAW ADI +RPAW K L  L+
Sbjct:   60 GDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGIKPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSKVKEVFDSRPRVSAWCADILARPAWVKGLEKLQ 212          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF2_TOBAC (Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.318e-45
Identity = 91/153 (59.48%), Postives = 113/153 (73.86%), Query Frame = -2
Query:  342 GDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLL-VWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 797
            GD KLFESRAITQYIA  + D G QL        P++ VW EVE  +F+P +SKL WEL  KP+ GMTTD  AV+E+E +L+K+LD+YE RL++SKYL  DSFTLVDLHH+PNI  L+ T VK++FD+RP VSAW ADI +RPAW K L  L+
Sbjct:   60 GDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGIKPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTKVKEVFDSRPRVSAWCADILARPAWVKGLEKLQ 212          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF_SILCU (Glutathione S-transferase OS=Silene cucubalus GN=GST PE=1 SV=3)

HSP 1 Score: 181.8 bits (460), Expect = 3.834e-45
Identity = 98/156 (62.82%), Postives = 118/156 (75.64%), Query Frame = -2
Query:  342 GDQKLFESRAITQYIA--QEFPDKGTQLTCPGK-PIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYL-ACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 797
            G+ KLFESRAIT+Y+A   +  ++GT L    K  +A  LVW+EVEA QFDP +SKL WELV+K +FGM TD   VEENEAKLAK+LDVYEARL++S+YL A DSFTLVDLHHLP +  L+GT VKKLF+ R HVSAW   I +RP+W K LAL K
Sbjct:   60 GEIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWELVFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLMGTQVKKLFEERAHVSAWCKKILARPSWEKTLALQK 215          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF6_ARATH (Glutathione S-transferase 6, chloroplastic OS=Arabidopsis thaliana GN=GST6 PE=1 SV=3)

HSP 1 Score: 180.644 bits (457), Expect = 8.542e-45
Identity = 95/154 (61.69%), Postives = 115/154 (74.68%), Query Frame = -2
Query:  342 GDQKLFESRAITQYIAQEFPDKGTQLTCPG--KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 797
            GD  LFESRAITQY+A+E+ +KG +L      K  A   VW +VE  QFDP +SKL +E V+K MFGMTTDPAAV+E E KL K+LDVYEARL++S++LA DSFTL DLHHLP I+ LLGT  K LFD+RP VS W   I++RPAWAKV+ L K
Sbjct:  109 GDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPKVSEWIKKISARPAWAKVIDLQK 262          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GST16_ARATH (Glutathione S-transferase 16 OS=Arabidopsis thaliana GN=GST16 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 9.774e-41
Identity = 90/152 (59.21%), Postives = 106/152 (69.74%), Query Frame = -2
Query:  354 GDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPIAPLLVWK---EVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 797
            GD KLFESRAITQYIA  + ++GT L     K IA   +     +VEA QFDP +SKL WE V+K  +G+ TD A V E EAKLAK+LDVYEARL + KYLA ++FTL DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KVL
Sbjct:   61 GDLKLFESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVL 212          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF4_ARATH (Glutathione S-transferase PM24 OS=Arabidopsis thaliana GN=PM24.1 PE=1 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 1.843e-39
Identity = 87/151 (57.62%), Postives = 107/151 (70.86%), Query Frame = -2
Query:  357 GDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPI---APLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKV 797
            GD KLFESRAITQYIA  + ++GT L     K I   A + +  +VE  QFDP +SKL +E ++K ++G+TTD A V E EAKLAK+LDVYEARL + KYLA ++FTL DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KV
Sbjct:   61 GDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKV 211          
BLAST of CF831916 vs. ExPASy Swiss-Prot
Match: GSTF3_MAIZE (Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4)

HSP 1 Score: 122.094 bits (305), Expect = 3.606e-27
Identity = 71/161 (44.10%), Postives = 96/161 (59.63%), Query Frame = -2
Query:  318 GDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKK-LFDARPHVSAWAADITSRPAWAKVLALLKH*TLCPLP 797
            GD+ LFESRAI +YIA ++  +GT L       A L VW EVE+  F P +S L ++L+ +P+ G   D A VE++  +LAK+LDVYEA L+++KYLA D FTL D +H     L    P +     ARPHV AW   I +RPA+ K +A +      PLP
Sbjct:   61 GDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFHPNASPLVFQLLVRPLLGGAPDAAVVEKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHALLPALTSARPPRPGCVAARPHVKAWWEAIAARPAFQKTVAAI------PLP 215          
The following BLAST results are available for this feature:
BLAST of CF831916 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
GSTF1_ARATH2.566e-4966.89Glutathione S-transferase 1 OS=Arabidopsis thalian... [more]
GSTF_HYOMU2.172e-4864.43Glutathione S-transferase OS=Hyoscyamus muticus PE... [more]
GST11_ARATH6.320e-4867.11Glutathione S-transferase 11 OS=Arabidopsis thalia... [more]
GSTF1_TOBAC2.655e-4659.48Glutathione S-transferase PARB OS=Nicotiana tabacu... [more]
GSTF2_TOBAC1.318e-4559.48Glutathione S-transferase APIC OS=Nicotiana tabacu... [more]
GSTF_SILCU3.834e-4562.82Glutathione S-transferase OS=Silene cucubalus GN=G... [more]
GSTF6_ARATH8.542e-4561.69Glutathione S-transferase 6, chloroplastic OS=Arab... [more]
GST16_ARATH9.774e-4159.21Glutathione S-transferase 16 OS=Arabidopsis thalia... [more]
GSTF4_ARATH1.843e-3957.62Glutathione S-transferase PM24 OS=Arabidopsis thal... [more]
GSTF3_MAIZE3.606e-2744.10Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A04_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831916 ID=CF831916|Name=CF831916|organism=Citrus sinensis|type=EST|length=801bp
TTTTTTTTTTTTTTGATAAACCCATTGGGACAGTCGTTCATTGACCCTTA
TAATTTTACACACAGGGCCATACGCAGAATATCTCCAGCTTCGTTTTATT
AGGGTACATAGATAAAATAAAAACCTCAAGCCATCAACATCAAAGTTGAA
TATGAGGCAGTGCTGTTGAAATACAAAAGCGGTAGTACAAACTACAAAGC
ATCAATATTCTGCAGAATATTGATGACAAACGCCAAACAAGAGAATACGA
ACTCGAAAACCAGCCTAATAGGTATTACAAAAGATAAGTGACCACCGAGG
AGCGACTAACGTCTAGTAGGTAGCGGGCAGAGTGTTCAGTGTTTGAGCAA
GGCAAGGACCTTAGCCCAAGCCGGTCTGGAAGTGATATCAGCTGCCCATG
CGCTAACATGGGGGCGTGCATCAAACAGCTTCTTGACAGGCGTCCCCAAC
AACAAATTAATATTGGGGAGATGATGCAAATCGACCAAGGTGAAGCTGTC
GCACGCCAAGTATTTGGACTGAGACAAACGGGCCTCGTAAACATCTAAAA
TTTTGGCAAGCTTAGCTTCATTTTCTTCAACCGCAGCTGGATCAGTGGTC
ATTCCAAACATTGGCTTGTACACGAGCTCCCAGTTGAGCTTCGATGATGG
GGGGTCGAACTGGAGTGCCTCCACCTCCTTCCATACCAATAACGGGGCGA
TGGGCTTGCCTGGGCATGTTAACTGGGTGCCTTTGTCTGGAAACTCCTGG
GCGATGTATTGGGTGATTGCCCTTGATTCGAAGAGCTTCTGGTCGCCGTG
T
back to top