CF831918

Overview
NameCF831918
Unique NameCF831918
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length856
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF831918_ssr250 microsatellite CF831918_ssr250:250..264. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig997 contig Csv1_Contig997:598..1454. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831918 vs. ExPASy Swiss-Prot
Match: TAP46_ARATH (PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana GN=TAP46 PE=1 SV=2)

HSP 1 Score: 280.026 bits (715), Expect = 1.153e-74
Identity = 138/214 (64.49%), Postives = 162/214 (75.70%), Query Frame = -1
Query:  167 AWLTTISLAVCKAXXXXXXXXXXXXXLSAVKERQLKGGEEEFSEVVLDERSKKAESWHRDAAIRAQYTKPAQPITCATFAQDVLEGRAKVSQAHEHKHQPMIFGPASLVGGGLTSERERLAAQVFQPMHRLPTMSIEEAGLKEMEMMNKWQERNVKLMEEANSAWYKDN-RKLGTSXXXXXXXXXDAVQKARAFDDWKDDNPRGAGNKKLTPCG 805
            AWL++I+LA+CKA             LSA+KERQLK GE  FS   LD+R+KKAE+WHRDAA R QY+KPAQPITCATFAQDVLEGRA VSQ HEHK+QP+IFGPAS+VGG L++ERER+ AQVFQP HR+PTM IE+AGL EM +MN WQE+  K +EEA ++WY D   +             +AV KARAFDDWKDDNPRGAGNKKLTPCG
Sbjct:  192 AWLSSINLAICKAIDLLEMLKREEEMLSAIKERQLKDGEGGFSRDALDDRTKKAETWHRDAAARIQYSKPAQPITCATFAQDVLEGRASVSQGHEHKNQPLIFGPASIVGGPLSTERERMIAQVFQPSHRMPTMCIEDAGLTEMNIMNDWQEQTKKAIEEATTSWYNDKPLRRKEEDEEDDDEDEEAVMKARAFDDWKDDNPRGAGNKKLTPCG 405          
The following BLAST results are available for this feature:
BLAST of CF831918 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TAP46_ARATH1.153e-7464.49PP2A regulatory subunit TAP46 OS=Arabidopsis thali... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A05_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831918 ID=CF831918|Name=CF831918|organism=Citrus sinensis|type=EST|length=856bp
TTTTTTTTTTTTTATCCTCGTATTCATTTAATACATTATGTGCGATGAAA
CTTTCATATTAAACCAGCAACCAATATACTTAAATATCTATAAATACAAA
ACTACAACAGTTATTCCATGCTTAGGAGAATACATGTAACATATTGAAAG
TAATTTGCATCTTTTAGCCACATGGGGTTAGTTTCTTATTGCCAGCTCCC
CGAGGATTATCATCTTTCCAGTCATCAAATGCTCTTGCCTTCTGTACAGC
ATCATCATCATCATCTTCATTGTCGTTTTCACTTGTTCCCAATTTCCTAT
TGTCCTTGTACCAAGCAGAATTGGCTTCTTCCATGAGTTTAACATTCCTC
TCCTGCCATTTATTCATCATTTCCATCTCCTTCAGCCCAGCCTCCTCTAT
ACTCATGGTCGGCAACCTATGCATAGGTTGGAAGACCTGCGCTGCCAACC
TTTCCCTCTCACTTGTCAGGCCTCCACCCACAAGACTTGCTGGTCCAAAT
ATCATTGGCTGGTGTTTGTGCTCATGTGCTTGTGAGACTTTGGCTCTTCC
TTCTAGAACATCCTGTGCAAAAGTAGCACATGTGATGGGCTGTGCTGGTT
TTGTGTATTGAGCTCGAATAGCAGCATCACGATGCCAAGATTCAGCTTTT
TTGGAGCGCTCATCAAGGACAACCTCAGAAAATTCCTCCTCACCTCCCTT
TAATTGTCTTTCTTTTACAGCAGAAAGCATATCTTCCTCTTTCTTCAGCA
TCTCTAGCAGATCAAGAGCCTTGCAAACAGCCAATGAGATGGTGGTAAGC
CAAGCCTCCCTTTCTTCTTCTCCATCGTCATCCAACACATCTTCCTCTCC
AGCCTC
back to top