CF831919

Overview
NameCF831919
Unique NameCF831919
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig997 contig Csv1_Contig997:1..696. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831919 vs. ExPASy Swiss-Prot
Match: TAP46_ARATH (PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana GN=TAP46 PE=1 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 1.778e-61
Identity = 122/207 (58.94%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   76 MGEVSREELPLPSLFERGRKIHQIATESGCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGELIEKIAQDDRLQILKASQAKLKEFISFCEIMXXXXXXXXXXXXQAKPTAFTDQRARKIARFKRQRAAESKLQEIKERKERRGRSTRAAAPSAPXXXXXXXXXXXXXXXXXXAWLTTISLAVCKALDL 696
            MG ++ EE+PL  LFE+ RKIH  A+ESG D D V+KGCE+ +KCEDM+GKL LFSSNETK+DIST NLKY+LVPY+L EL EKI Q+DR+QI+KAS AKLKEF SFCE M            +    A  D+RA KIARFKRQ+AAE+KL EIKERKERRGRST+A+A S P                  AWL++I+LA+CKA+DL
Sbjct:    1 MGGLAMEEMPLSVLFEQARKIHLAASESGVDQDVVKKGCEMFQKCEDMIGKLALFSSNETKEDISTNNLKYLLVPYYLAELTEKIIQEDRIQIVKASYAKLKEFFSFCEAMELVPDEELEASSRGGSGAPADRRALKIARFKRQKAAEAKLLEIKERKERRGRSTKASALSTPVESGEDDIPDDDSEEEREAWLSSINLAICKAIDL 207          
BLAST of CF831919 vs. ExPASy Swiss-Prot
Match: IGBP1_HUMAN (Immunoglobulin-binding protein 1 OS=Homo sapiens GN=IGBP1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.292e-11
Identity = 54/173 (31.21%), Postives = 89/173 (51.45%), Query Frame = 1
Query:   97 ELP-LPSLFERGRKIH---QIATE---SGCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGEL-IEKIAQDDRLQILKASQAKLKEFISFC-----------EIMXXXXXXXXXXXXQAKPT--AFTDQRARKIARFKRQRAAESKLQEIKERKE 552
            +LP LP LFE GR++    ++ATE   S    + V KG ++LEK  +M+ +L LFS NE  ++I++ +LKY+LVP F G L ++++    RL  L+ ++     +++ C           + M             A P+  A   QR  KI R+K+++  E +L  +K   E
Sbjct:    8 QLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVE 180          
BLAST of CF831919 vs. ExPASy Swiss-Prot
Match: YCJ5_SCHPO (Uncharacterized protein C63.05 OS=Schizosaccharomyces pombe GN=SPCC63.05 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11
Identity = 42/154 (27.27%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  112 SLFERGRKIHQIATESGCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGELIEKIAQDDRLQILKASQAKLKEFISFCEIMXXXXXXXXXXXXQAKPTAFTDQRARKIARFKRQRAAESKLQEIKERKERRGRSTR 573
            SL E   +  ++   S  D     +  E  EKC  +V +L +FSSNE  D+I T+ L+Y+++ Y L + +E+  + DRL+ ++ ++   + F+S C+                KP    D R  KIAR++ ++  E +L+ + +  E      R
Sbjct:    5 SLRELWEETEKLKDSSSTDEKTRSEIVEGYEKCLKLVLQLRIFSSNEEVDEIKTSELRYLMIDYELAKCVEQWTKGDRLKAVQYAKTHYETFLSICD------DYGLKPMQDEKPKTEADTRTLKIARYRMRQNLEKELKALSKDSETNEEQER 152          
BLAST of CF831919 vs. ExPASy Swiss-Prot
Match: IGBP1_RAT (Immunoglobulin-binding protein 1 OS=Rattus norvegicus GN=Igbp1 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11
Identity = 55/178 (30.90%), Postives = 86/178 (48.31%), Query Frame = 1
Query:   88 SREEL---PLPSLFERGRKIHQ---IATE---SGCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGEL-IEKIAQDDRLQILKASQAKLKEFISFC------EIMXXXXXXXXXXXXQAKPT-------AFTDQRARKIARFKRQRAAESKLQEIKERKE 552
            S EEL    LP LFE  +K+ +   +ATE   S    D V KG E+LEK   M+ +L LFS NE  ++I++ +LKY++VP   G L ++++    RL  L+ ++     F++ C      E               A+ +       A   QR  KI R+K+++  E +L  +K   E
Sbjct:    4 SEEELLLPRLPELFETSKKLLEELEVATEPTGSRTIQDKVSKGLELLEKAAGMLSQLDLFSRNEDLEEIASIDLKYLMVPALQGALTMKQVNPSKRLDHLQRAREHFIHFLTQCHCYHVAEFQLPQTKNNSAENNTARSSMAYPNLVAMASQRQAKIERYKQKKEVEHRLSALKSAVE 181          
The following BLAST results are available for this feature:
BLAST of CF831919 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
TAP46_ARATH1.778e-6158.94PP2A regulatory subunit TAP46 OS=Arabidopsis thali... [more]
IGBP1_HUMAN1.292e-1131.21Immunoglobulin-binding protein 1 OS=Homo sapiens G... [more]
YCJ5_SCHPO2.204e-1127.27Uncharacterized protein C63.05 OS=Schizosaccharomy... [more]
IGBP1_RAT8.376e-1130.90Immunoglobulin-binding protein 1 OS=Rattus norvegi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A05_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831919 ID=CF831919|Name=CF831919|organism=Citrus sinensis|type=EST|length=696bp
TTGCAAGTCTGCCCCTGAACGTTTCAAATATTTCCAAATTCACAACTGAA
ATCTAGGGTTTTGATACGGTGACCGATGGGTGAGGTATCAAGGGAGGAGC
TGCCACTGCCTTCGCTCTTTGAACGAGGACGAAAGATCCACCAGATAGCT
ACGGAATCCGGTTGCGATCCGGATGCTGTGAGGAAAGGATGTGAGGTTTT
GGAGAAGTGCGAGGATATGGTCGGTAAGCTAGGATTGTTCTCATCGAATG
AGACCAAAGATGATATCAGCACCGCCAATCTCAAGTATATTCTGGTGCCG
TATTTTCTTGGCGAGCTGATTGAAAAAATTGCACAGGATGATAGGTTACA
GATTCTTAAAGCTTCCCAGGCTAAATTGAAGGAGTTTATTTCATTTTGTG
AGATAATGGAACTTGTACCAGAAGAGGAGTTGGAAGCCGTTGCACAAGCC
AAGCCAACTGCTTTCACAGATCAAAGGGCCCGGAAGATTGCTCGGTTCAA
ACGTCAAAGAGCAGCAGAATCAAAACTTCAGGAAATAAAGGAGCGGAAGG
AGAGGCGTGGGCGTTCGACTAGAGCAGCCGCTCCATCTGCTCCTGTTGAG
GCTGGAGAGGAAGATGTGTTGGATGACGATGGAGAAGAAGAAAGGGAGGC
TTGGCTTACCACCATCTCATTGGCTGTTTGCAAGGCTCTTGATCTG
back to top