CF831922

Overview
NameCF831922
Unique NameCF831922
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length871
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF831922_ssr191 microsatellite CF831922_ssr191:191..200. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CF831922 vs. ExPASy Swiss-Prot
Match: SERA_ARATH (D-3-phosphoglycerate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At1g17745 PE=1 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 1.498e-77
Identity = 143/203 (70.44%), Postives = 176/203 (86.70%), Query Frame = -1
Query:  263 QLVAGGSGVKTVKVSYASSRAPDDLDTRLLRAMITKGLIEPISDVFVNLVNADYTAKQRGLRLTEERILLDGSPESPLEFIQVQIANVESKFASAISESGEIKVEGRVKDGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGNILGSENVNVSFMSVGRVAPRKHAVMAIGVDEQPRKETLKKIGDVPAIEEFVFLKL 871
            QL +GG GV++++V Y S+R  DDLDTRLLRAMITKG+IEPISD +VNLVNAD+ AKQ+GLR++EER+++D SPE P++ IQVQI NVES FA A+S++G+I +EG+VK GVPHLT VGSF VDVSLEG++ILCRQVDQPGMIG+VGNILG +NVNV+FMSVGR   RK A+MAIGVDE+P  +TL++IG V AIEEFVFLKL
Sbjct:  422 QLASGGKGVQSIRVVYRSARDRDDLDTRLLRAMITKGIIEPISDSYVNLVNADFIAKQKGLRISEERMVVDSSPEYPVDSIQVQILNVESNFAGAVSDAGDISIEGKVKYGVPHLTCVGSFGVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVNFMSVGRTVLRKQAIMAIGVDEEPDNKTLERIGGVSAIEEFVFLKL 624          
BLAST of CF831922 vs. ExPASy Swiss-Prot
Match: SERA_METJA (D-3-phosphoglycerate dehydrogenase OS=Methanocaldococcus jannaschii GN=serA PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.516e-16
Identity = 55/200 (27.50%), Postives = 96/200 (48.00%), Query Frame = -1
Query:  263 VKTVKVSYASSRAPDDLDTRLLRAMITKGLIEPISDVFVNLVNADYTAKQRGLRLTEERILLDGSPESPLEFIQVQIANVESKFASAI-----SESGEIKVEGRVKDGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGNILGSENVNVSFMSVGRVAPRKHAVMAIGVDEQPRKETLKKIGDVPAIEEFVFLKL 847
            V  V++ Y+   A +  D  L++    KGL+ PI    +NLVNA   AK R + + E                    +  E K+ +AI     S+  +  + G + +  P + +V  +EV    EG + + + +D+PG IG+V   LG   +N++ M VGR  P   +VM + +D    +E ++KI ++P I++   + L
Sbjct:  346 VNRVELIYSGELAKEKTD--LIKRAFLKGLLSPILLAGINLVNAPIIAKNRNINVVES-------------------STSEEKYGNAIKITAESDKKKFSIVGAIINNKPVILEVDGYEVSFIPEGVLAIIKHIDRPGTIGRVCITLGDYGINIASMQVGRKEPGGESVMLLNLDHTVPEEVIEKIKEIPNIKDVAVINL 524          
BLAST of CF831922 vs. ExPASy Swiss-Prot
Match: SERA_METTH (D-3-phosphoglycerate dehydrogenase OS=Methanobacterium thermoautotrophicum GN=serA PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.075e-14
Identity = 57/196 (29.08%), Postives = 97/196 (49.49%), Query Frame = -1
Query:  263 VKTVKVSYASSRAPDDLDTRLLRAMITKGLIEPISDVFVNLVNADYTAKQRGLRLTEERILLDGSPESPLEFIQVQIANVESKFASAISESGEIKVEG-RVKDGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGNILGSENVNVSFMSVGRVAPRKHAVMAIGVDEQPRKETLKKIGDVPAIEEFVFLKL 847
            ++ + V+Y    A    D  L R M+ + ++ PI    VNL+NA   AK+RG+ +TE R        S +              A+A S+ G   VE   +K+  P +  +  + VDV  EG++I+ R  D PG IG +G  LG   +N++ M VGR      AVM + VD+    E ++++  +  +++ V +++
Sbjct:  347 IEKLDVTYCGELAEMQFDI-LTRTML-QAILNPILTEPVNLINAPSIAKKRGIMVTEARRSESDGYRSII-------------IATAESDRGGFSVEATHIKE--PTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGQHGINIATMQVGRKEIGGEAVMVLKVDQSVPAEVIEEVKKLDNVDDAVAIEI 525          
BLAST of CF831922 vs. ExPASy Swiss-Prot
Match: SERA_SYNY3 (D-3-phosphoglycerate dehydrogenase OS=Synechocystis sp. (strain PCC 6803) GN=serA PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 9.893e-13
Identity = 53/170 (31.18%), Postives = 82/170 (48.24%), Query Frame = -1
Query:  263 KGLIEPISDVFVNLVNADYTAKQRGLRLTEERILLDGSPESPLEFIQVQIANV--ESKFASAISESGEIKVEGRVKDGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGNILGSENVNVSFMSVGRVAPRKHAVMAIGVDEQPRKETLKKIGDVPAIEEFVFLKL 766
            KGL+       VN VNA   AK+RG+R+ E +   D S       + ++      E     A+  +GEI++           T V  F ++V     ++     D PG+IGK+G++LGS NVN++ M VGR   R  A+MA+ +D+      L +I  V  I +   +KL
Sbjct:  399 KGLLSQALRERVNYVNAAIEAKERGIRVIETK---DASVRDYSGSLHLKATGTMGEHSATGALLSNGEIRI-----------TDVDEFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKIVRGDAIMALSLDDPLPDGLLSEITKVAGIRDAYTVKL 554          
BLAST of CF831922 vs. ExPASy Swiss-Prot
Match: SERA_BACSU (D-3-phosphoglycerate dehydrogenase OS=Bacillus subtilis GN=serA PE=3 SV=3)

HSP 1 Score: 73.559 bits (179), Expect = 1.688e-12
Identity = 54/190 (28.42%), Postives = 88/190 (46.32%), Query Frame = -1
Query:  287 VKTVKVSYASSRAPDDLDTRLLRAMITKGLIEPISDVFVNLVNADYTAKQRGLRLTEERILLDGSPESPLEFIQVQIANVESKF---ASAISESGEIKVEGRVKDGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGNILGSENVNVSFMSVGRVAPRKHAVMAIGVDEQPRKETLKKIGDVPAI 847
            V+ V + Y  + A   L+T  +   +  G ++P  D  VN VNA   AK+RG+  +E+   +  S       I V++    S F   A+ I   GE  VE            +  F +D    G ++  +  D  G+IG+VG ILG  ++N++ M VGR      A+M +  D     + +K++ +VP I
Sbjct:  344 VQDVAIQYEGTIAK--LETSFITKALLSGFLKPRVDSTVNEVNAGGVAKERGISFSEK---ISSSESGYDNCISVKVTGDRSTFTVTATYIPHFGERIVE------------INGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIMMLSFDRHLEDKIVKELTNVPDI 516          
BLAST of CF831922 vs. ExPASy Swiss-Prot
Match: SERA_ARCFU (D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus GN=serA PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.204e-12
Identity = 54/200 (27.00%), Postives = 97/200 (48.50%), Query Frame = -1
Query:  263 GSGVKTVKVSYASSRAPDDLDTRLLRAMITKGLIEPISDVFVNLVNADYTAKQRGLRLTEERILLDGSPESPLEFIQVQIANVESKFASAISESGEIKVEGRVKDGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGNILGSENVNVSFMSVGRVAPRKHAV--MAIGVDEQPRKETLKKIGDVPAIEEFVFLKL 856
            G  ++ VKV+ +   A  +  T  +   + KGL EPI    +NLV+A   A +RG+ + E ++      ES LE + V+            S   E+ + G        + K+  + V+   +G  I+    D+PG+IG+VG + G  N+N++ M VGR   +   +  M + VD+ P  E L+++  +  I +  +++L
Sbjct:  343 GGAIRKVKVTCSGKLATKN--TEFVTRALLKGLFEPILSNEINLVSAKPVAVERGITIEESKVESVEHYESLLE-VWVE------------SNGKEMYLAGTCFGNEYRILKIDVYNVNFVPKGHYIISLHEDKPGVIGRVGTLFGRNNINIAGMIVGRSGDKPGGIQLMLLLVDDPPTPEVLEEMTKLDGIIDATYVEL 527          
The following BLAST results are available for this feature:
BLAST of CF831922 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
SERA_ARATH1.498e-7770.44D-3-phosphoglycerate dehydrogenase, chloroplastic ... [more]
SERA_METJA2.516e-1627.50D-3-phosphoglycerate dehydrogenase OS=Methanocaldo... [more]
SERA_METTH3.075e-1429.08D-3-phosphoglycerate dehydrogenase OS=Methanobacte... [more]
SERA_SYNY39.893e-1331.18D-3-phosphoglycerate dehydrogenase OS=Synechocysti... [more]
SERA_BACSU1.688e-1228.42D-3-phosphoglycerate dehydrogenase OS=Bacillus sub... [more]
SERA_ARCFU2.204e-1227.00D-3-phosphoglycerate dehydrogenase OS=Archaeoglobu... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A08_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831922 ID=CF831922|Name=CF831922|organism=Citrus sinensis|type=EST|length=871bp
GGGCCCCTTTTAGCGACTAAGAAACTTCATTTAAGATGATAACAACTCGA
TTAAAGCCTCACAACAAACCCTTTCTTCGCAAAGCACAATTAATTATTCA
TTTATCTTTCCTAAAACTGCCAGCCTAACAAAGAACAGTAAAATGAAAGT
CCTAAAAATCGTGCACTACAATGCGGTAAAGACACCCATTTCTCTCTCTC
CGAGGACGGAAAAAATAATAGCATAAAAAATTTGGATGTGGTGGTGACGC
TGAGACACATTACAACTTAAGGAAAACAAACTCTTCTATGGCGGGAACAT
CACCAATCTTTTTCAATGTTTCTTTGCGGGGTTGTTCATCCACTCCAATT
GCCATCACCGCATGCTTCCGCGGAGCAACCCTTCCAACACTCATGAAACT
GACATTCACATTCTCACTTCCCAAAATATTTCCCACTTTGCCGATCATAC
CTGGCTGATCAACCTGTCTGCAGAGTATGATGCTGCCTTCCAAACTCACA
TCCACCTCAAAAGATCCTACCTTTGTCAAATGTGGAACTCCATCCTTCAC
TCGTCCCTCGACCTTGATCTCCCCAGACTCGGATATGGCACTGGCAAATT
TTGATTCCACATTGGCAATCTGAACCTGGATGAATTCGAGTGGACTCTCA
GGTGAACCATCTAGGAGAATTCGTTCTTCAGTTAACCGGAGGCCTCTCTG
TTTGGCTGTGTAATCAGCATTAACTAAGTTCACAAAAACATCAGATATGG
GCTCAATCAGACCCTTGGTGATCATGGCACGGAGCAATCTTGTGTCAAGG
TCATCGGGGGCCCTCGAAGAAGCATACGACACTTTCACGGTTTTCACACC
ACTTCCTCCTGCTACCAGTTG
back to top