CF831923

Overview
NameCF831923
Unique NameCF831923
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1300 contig Csv1_Contig1300:73..802. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_ARATH (D-3-phosphoglycerate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At1g17745 PE=1 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 3.388e-58
Identity = 114/171 (66.67%), Postives = 135/171 (78.95%), Query Frame = 2
Query:  218 KPTVLIAEKLGQAGLDLLQEFANVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            KP +L+ EKLG+AG++LL+EF +VDC+Y+LSPE+L  K++  DALIVRSGTKV R+VFE++ GRLKVVGRAGVGIDNVDL AATE GCL                        RNVAQADAS+KAGKW+R+KYVGVSLVGKTLAV+GFGKVG+EVARRAKGLGM VI+HDP
Sbjct:   82 KPRILVTEKLGEAGVNLLREFGDVDCSYDLSPEDLKKKVAESDALIVRSGTKVTREVFEAAKGRLKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASIKAGKWERSKYVGVSLVGKTLAVMGFGKVGTEVARRAKGLGMTVISHDP 252          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_METJA (D-3-phosphoglycerate dehydrogenase OS=Methanocaldococcus jannaschii GN=serA PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.212e-33
Identity = 72/168 (42.86%), Postives = 102/168 (60.71%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFANVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            +L+ + L +  + +L+E   V+ A  L+ EEL  KI   D L+VRSGTKV RDV E  A +LKV+GRAGVG+DN+D+ AATE G +                        RN+ QA AS+K G+W R ++ G+ L GKTL V+G G++G +V +RAK  GM++I +DP
Sbjct:    4 ILVTDPLHEDAIKILEEVGEVEVATGLTKEELLEKIKDADVLVVRSGTKVTRDVIEK-AEKLKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIPQATASLKRGEWDRKRFKGIELYGKTLGVIGLGRIGQQVVKRAKAFGMNIIGYDP 170          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_METTH (D-3-phosphoglycerate dehydrogenase OS=Methanobacterium thermoautotrophicum GN=serA PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.531e-31
Identity = 70/168 (41.67%), Postives = 102/168 (60.71%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFANVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLIA+ + + G+  L+E A V     ++PEEL   I   DA++VRS TKV R+V E+ A RLK++ RAGVG+DNVD+ AAT+ G +                        R +A AD SVK GKW++N+++G+ L GKTL ++G G++GS+V  R K  GM ++ +DP
Sbjct:    6 VLIADSINEKGISELEEVAEVVVNTTITPEELLDAIKDFDAIVVRSRTKVTREVIEA-APRLKIIARAGVGVDNVDVKAATDRGIMVINAPESTSITVAEHSIGLMLALARKIAIADRSVKEGKWEKNRFMGIELNGKTLGIIGMGRIGSQVVVRTKAFGMDIMVYDP 172          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_ARCFU (D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus GN=serA PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.640e-28
Identity = 67/169 (39.64%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VL+AE + +  +D +++    V+    +S EEL  ++   +A++VRS TKV+ +V ++ A  LK++GRAGVG+DN+D+ AAT+ G +                        R + QAD SVK GKW+R K++G+ L GKT  V+G G+VG EVA+R K L M+V+A+DP
Sbjct:    3 VLVAEPISEEAIDYMRKNGLEVEVKTGMSREELIREVPKYEAIVVRSQTKVDAEVIQA-AKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIPQADRSVKEGKWERKKFMGIELRGKTAGVIGLGRVGFEVAKRCKALEMNVLAYDP 170          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_PONAB (D-3-phosphoglycerate dehydrogenase OS=Pongo abelii GN=PHGDH PE=2 SV=3)

HSP 1 Score: 124.02 bits (310), Expect = 8.140e-28
Identity = 74/169 (43.79%), Postives = 96/169 (56.80%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLI++ L      +LQ+    V    NLS EEL  ++  C+ LIVRS TKV  DV  ++A +L+VVGRAG G+DNVDL AAT  G L                        R + QA AS+K GKW+R K++G  L GKTL +LG G++G EVA R + LGM  I +DP
Sbjct:    9 VLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVAIRMQSLGMKTIGYDP 176          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_PANTR (D-3-phosphoglycerate dehydrogenase OS=Pan troglodytes GN=PHGDH PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.389e-27
Identity = 73/169 (43.20%), Postives = 95/169 (56.21%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLI++ L      +LQ+    V    NLS EEL  ++  C+ LIVRS TKV  DV  ++A +L+VVGRAG G+DNVDL AAT  G L                        R + QA AS+K GKW+R K++G  L GKTL +LG G++G EVA R +  GM  I +DP
Sbjct:    9 VLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDP 176          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_MACFA (D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis GN=PHGDH PE=2 SV=4)

HSP 1 Score: 123.25 bits (308), Expect = 1.389e-27
Identity = 73/169 (43.20%), Postives = 95/169 (56.21%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLI++ L      +LQ+    V    NLS EEL  ++  C+ LIVRS TKV  DV  ++A +L+VVGRAG G+DNVDL AAT  G L                        R + QA AS+K GKW+R K++G  L GKTL +LG G++G EVA R +  GM  I +DP
Sbjct:    9 VLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-NAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDP 176          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_HUMAN (D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4)

HSP 1 Score: 123.25 bits (308), Expect = 1.389e-27
Identity = 73/169 (43.20%), Postives = 95/169 (56.21%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLI++ L      +LQ+    V    NLS EEL  ++  C+ LIVRS TKV  DV  ++A +L+VVGRAG G+DNVDL AAT  G L                        R + QA AS+K GKW+R K++G  L GKTL +LG G++G EVA R +  GM  I +DP
Sbjct:    9 VLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDP 176          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_PIG (D-3-phosphoglycerate dehydrogenase OS=Sus scrofa GN=PHGDH PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.368e-27
Identity = 72/169 (42.60%), Postives = 95/169 (56.21%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLI++ L     ++LQ+    V    NLS EEL  ++  C+ LIVRS TKV  DV  ++A +L+VVGRAG G+DNVDL AAT  G L                        R + QA AS+K GKW+R K++G  L GK L +LG G++G EVA R +  GM  I +DP
Sbjct:    9 VLISDSLDPCCREILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTSDVI-NAAKKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMILCLARQIPQATASMKDGKWERKKFMGTELNGKVLGILGLGRIGREVATRMQSFGMKTIGYDP 176          
BLAST of CF831923 vs. ExPASy Swiss-Prot
Match: SERA_MOUSE (D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 3.093e-27
Identity = 72/169 (42.60%), Postives = 94/169 (55.62%), Query Frame = 2
Query:  227 VLIAEKLGQAGLDLLQEFA-NVDCAYNLSPEELCTKISLCDALIVRSGTKVNRDVFESSAGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXXXXXXXXXXXXRNVAQADASVKAGKWQRNKYVGVSLVGKTLAVLGFGKVGSEVARRAKGLGMHVIAHDP 730
            VLI++ L      +LQ+    V    NLS EEL  ++  C+ LIVRS TKV  DV  ++A +L+VVGRAG G+DNVDL AAT  G L                        R + QA AS+K GKW R K++G  L GKTL +LG G++G EVA R +  GM  + +DP
Sbjct:    9 VLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTVGYDP 176          
The following BLAST results are available for this feature:
BLAST of CF831923 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
SERA_ARATH3.388e-5866.67D-3-phosphoglycerate dehydrogenase, chloroplastic ... [more]
SERA_METJA2.212e-3342.86D-3-phosphoglycerate dehydrogenase OS=Methanocaldo... [more]
SERA_METTH3.531e-3141.67D-3-phosphoglycerate dehydrogenase OS=Methanobacte... [more]
SERA_ARCFU1.640e-2839.64D-3-phosphoglycerate dehydrogenase OS=Archaeoglobu... [more]
SERA_PONAB8.140e-2843.79D-3-phosphoglycerate dehydrogenase OS=Pongo abelii... [more]
SERA_PANTR1.389e-2743.20D-3-phosphoglycerate dehydrogenase OS=Pan troglody... [more]
SERA_MACFA1.389e-2743.20D-3-phosphoglycerate dehydrogenase OS=Macaca fasci... [more]
SERA_HUMAN1.389e-2743.20D-3-phosphoglycerate dehydrogenase OS=Homo sapiens... [more]
SERA_PIG2.368e-2742.60D-3-phosphoglycerate dehydrogenase OS=Sus scrofa G... [more]
SERA_MOUSE3.093e-2742.60D-3-phosphoglycerate dehydrogenase OS=Mus musculus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A08_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831923 ID=CF831923|Name=CF831923|organism=Citrus sinensis|type=EST|length=730bp
CTGCACTCCCTCTATCCATACGACGCCGCTTTAACCACCCCGAAAAATGG
CCACGTCAGCAGCCTCCTACGCTGCCTCCCTCCGTCAGCCTTCCCTCAAG
CTATCACTGTCTTCCAAACAGTCTCTTTCCCCTCTATTCTCCGTCTCCTT
CAACCGCAAGCGGGCCCCGCCGCGGCTCGTAATAATCGCATCCGCCGCCG
CTGACGGCATCTCCTCAAAACCGACCGTTTTGATCGCCGAGAAGCTCGGA
CAGGCCGGCTTGGATCTTCTTCAAGAGTTCGCCAACGTGGACTGCGCATA
CAACTTGTCGCCAGAGGAGCTCTGCACGAAGATCTCGCTGTGCGACGCGC
TGATCGTGCGCAGCGGCACGAAGGTCAATCGCGACGTGTTCGAGTCGTCA
GCTGGAAGGTTGAAGGTCGTTGGGAGAGCCGGTGTTGGTATTGATAATGT
GGATCTGGCTGCGGCTACTGAGTTTGGTTGCTTGGTTGTGAACGCGCCGA
CGGCGAATACCGTTGCGGCTGCTGAGCATGGGATCGCGCTTTTGGCTGCC
ATGGCTAGAAATGTCGCCCAGGCTGATGCCTCTGTTAAGGCTGGAAAGTG
GCAAAGGAACAAATATGTGGGTGTCTCCCTTGTGGGTAAAACACTTGCTG
TATTGGGATTCGGAAAGGTTGGATCAGAAGTTGCTCGTCGTGCCAAGGGT
CTGGGTATGCATGTCATTGCACATGATCCG
back to top