CF831924

Overview
NameCF831924
Unique NameCF831924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length844
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1911 contig Csv1_Contig1911:521..1364. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER56_ARATH (Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 7.850e-52
Identity = 105/186 (56.45%), Postives = 126/186 (67.74%), Query Frame = -2
Query:  241 WEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMELRNQD--KFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVIN 792
            WEV TGRRDG V+   EA L LPSPF N S L   F  KGL  KDLVVLSGGHTIG  HC   +NRLYNFTG GD DP+LD  YA  L+ KCK   DTTT  E+DPGSF+ FD  Y+ +  + +GLFQSDAALL N+  ++ V++  N D   FF +F  SM +MG + VLTG  GE+RKKC ++N
Sbjct:  145 WEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLRGKCKP-TDTTTALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQETKSYVLKSLNSDGSTFFKDFGVSMVKMGRIGVLTGQVGEVRKKCRMVN 329          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER3_ARATH (Peroxidase 3 OS=Arabidopsis thaliana GN=PER3 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 3.298e-50
Identity = 107/205 (52.20%), Postives = 143/205 (69.76%), Query Frame = -2
Query:  238 ALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKT-KCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMEL--RNQDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVINN 843
            ALA+RD+V F    P+ W V TGRRDG +S AAEA   +P P +N + L+  F ++GL +KDLV+LSG HTIGVSHC+ F+NRLYNFTG G QDP+LD  YAA LK+ KC SL D  T  E+DPGS + FD  YY + ++ +GLFQSD+AL TN    + +  +   +   FF EFA+SM++MG +NV TG+ G +R++CSV N+
Sbjct:  124 ALASRDAVVFT-GGPN-WSVPTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYNFTGRGGQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTGSAGVVRRQCSVANS 326          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER39_ARATH (Peroxidase 39 OS=Arabidopsis thaliana GN=PER39 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 4.308e-50
Identity = 108/203 (53.20%), Postives = 137/203 (67.49%), Query Frame = -2
Query:  241 LATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKT-KCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMELR--NQDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVIN 840
            LATRDS+      P  W V TGRRDG +S  AEA   +P PF NF+ L   F ++GL VKDLV+LSG HTIGVSHC+ FSNRL+NFTG GDQDPSLD  YA  LK+ +C S+AD TT  E+DPGS   FD  YY + ++ +GLF+SDAAL  N  A   V      ++ +FF EF+ SM++MG + V TG+ GEIR+ C+ +N
Sbjct:  126 LATRDSI-VAIGGPT-WNVPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRTCAFVN 326          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER27_ARATH (Peroxidase 27 OS=Arabidopsis thaliana GN=PER27 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.792e-49
Identity = 108/203 (53.20%), Postives = 130/203 (64.04%), Query Frame = -2
Query:  241 ALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVME--LRNQDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVIN 843
            AL  RD++    + P  WEV TGRRDG VS   E +L  PSPF N ++L  +F  KGL  KDLV+LSGGHTIG+ HC   +NRLYNFTG GD DPSLD  YAA L+ KCK   DTTT  E+DPGSF+ FD  Y+ +  + +GLFQSDAALL N   R  V++    +   FF +F  SM +MG   VLTG  GEIRK C   N
Sbjct:  124 ALVARDAM-VALEGPS-WEVETGRRDGRVSNINEVNL--PSPFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKCKP-TDTTTALEMDPGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFFNDFGVSMVKMGRTGVLTGKAGEIRKTCRSAN 321          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER1_ORYSJ (Peroxidase 1 OS=Oryza sativa subsp. japonica GN=PRX74 PE=2 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 8.124e-49
Identity = 110/207 (53.14%), Postives = 134/207 (64.73%), Query Frame = -2
Query:  241 ALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTG---NGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMELRN---QDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVIN 843
            AL  RD+V     K   W V  GRRDG VSIA E D L P P ANF+EL + F  K L +KDLVVLS GHTIG SHC  F++RLYNFTG     D DP+L+ +Y A L++KC SL D TT  E+DPGSF+ FD  Y+    + +GLF SD  LLTN   R  V        +D+FF +FA SM +MG + VLTG+QGEIRKKC+V+N
Sbjct:  123 ALMARDAV--WLSKGPFWAVPLGRRDGRVSIANETDQL-PPPTANFTELTQMFAAKNLDLKDLVVLSAGHTIGTSHCFSFTDRLYNFTGLDNAHDIDPTLELQYMARLRSKCTSLQDNTTLVEMDPGSFKTFDLGYFKNVAKRRGLFHSDGELLTNGFTRAYVQRHAGGGYKDEFFADFAASMVKMGGVEVLTGSQGEIRKKCNVVN 326          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER30_ARATH (Peroxidase 30 OS=Arabidopsis thaliana GN=PER30 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.532e-47
Identity = 97/185 (52.43%), Postives = 128/185 (69.19%), Query Frame = -2
Query:  247 WEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLK-TKCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMELRN--QDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSV 792
            W V TGRRDG +S   EA   +P P +NF+ L++ F ++GL +KDLV+LSG HTIGVSHC+  + RLYNF+    QDPSLD +YAA LK  KCKSL D +T  E+DPGS R FD  YY + ++ +GLFQSD+AL TN     ++ +L N  + KFF  FA+SM++MG + V TG+ G IR +CSV
Sbjct:  142 WSVPTGRRDGRISNKTEATNNIPPPTSNFTTLQRLFKNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSQYAANLKANKCKSLNDNSTILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAKSMEKMGRVKVKTGSAGVIRTRCSV 326          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER24_ARATH (Peroxidase 24 OS=Arabidopsis thaliana GN=PER24 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 7.604e-47
Identity = 105/205 (51.22%), Postives = 136/205 (66.34%), Query Frame = -2
Query:  241 LATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKC--KSL-ADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMELRNQDKFFPEFAQSMKRMGAMNVLT-GTQ-GEIRKKCSVIN 840
            LA RD+VS++F++P LW V TGR DG VS+A EA   LPS  ANF+ L+K F +  L V DLV LSG HTIG++HC  F  RL NFTG GD DPSL+P YA+FLK++C  KSL  + +    +DP     FDS Y+   ++NKGLF SDAALLT+  A +I    +N   F  +F +SM +M ++ VLT G Q GEIRK C ++N
Sbjct:  147 LAARDAVSYEFERP-LWNVFTGRVDGRVSLATEAARDLPSAGANFTTLQKLFAESDLDVVDLVALSGAHTIGIAHCGVFGRRLLNFTGKGDTDPSLNPSYASFLKSECSDKSLRLNPSAVVGMDPTGPLAFDSGYFVSLLKNKGLFTSDAALLTDPSAAHIASVFQNSGAFLAQFGRSMIKMSSIKVLTLGDQGGEIRKNCRLVN 350          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER1_ARATH (Peroxidase 1/2 OS=Arabidopsis thaliana GN=PER1 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.868e-44
Identity = 97/205 (47.32%), Postives = 125/205 (60.98%), Query Frame = -2
Query:  241 ALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTNKGARNIVMELRNQ----DKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVIN 843
            AL  RD+V+        W V  GRRDG +S   +A L LPSPFA+   LKKNF +KGL  KDLVVLSGGHTIG+S C   ++RLYNFTG GD DPS++P Y   LK KC    D  T+  +DPGS   FD+HY+ +  + KGLF SD+ LL +   +N V            F  +F+ SM ++G + +LTG  GEIRK+C+  N
Sbjct:  124 ALVARDAVAVI--GGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCPP-TDFRTSLNMDPGSALTFDTHYFKVVAQKKGLFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLGFVQILTGKNGEIRKRCAFPN 325          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER5_VITVI (Peroxidase 5 OS=Vitis vinifera GN=GSVIVT00037159001 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.202e-37
Identity = 90/204 (44.12%), Postives = 120/204 (58.82%), Query Frame = -2
Query:  238 ALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKC-KSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALLTN-KGARNIVMELRNQDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVINN 843
            A A RDSV         ++V  GRRDG +S+A+EA   LP P     +L + F++KGLT  ++V LSG HTIG SHC+ FSNRLYNF G   QDP+LDP+YAA LKT+C +   +T     ++P S    D  YY   + N+GLF SD  LLT+   A  +     N   +  +FA +M +MG + VL G  G+IR  C VIN+
Sbjct:  161 AFAARDSVEITGGLG--YDVPAGRRDGRISLASEASTNLPPPTFTVDQLTQFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYAASLKTQCPQGSTNTNLVVPMNPSSPSITDVGYYVDVLRNRGLFTSDQTLLTDTTTATQVRQNAGNPFLWKNKFASAMVKMGQLGVLIGEAGQIRANCRVINS 362          
BLAST of CF831924 vs. ExPASy Swiss-Prot
Match: PER14_ARATH (Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.039e-36
Identity = 88/203 (43.35%), Postives = 121/203 (59.61%), Query Frame = -2
Query:  238 LATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDIFIENKGLFQSDAALL-TNKGARNIVME-LRNQDKFFPEFAQSMKRMGAMNVLTGTQGEIRKKCSVINN 840
            LA RDS S     P  W V  GRRD + +  A+ +  LP P   F  +   F+++GL + DLV LSG HTIG S CT F  RLYN +G+G  D +L+  YAA L+ +C         +ELD  S  +FD+ Y+   IEN GL  SD  L  +N+ +R +V +   +Q++FF +FA+SM +MG ++ LTG+ GEIRKKC  INN
Sbjct:  136 LAARDS-SVLTGGPS-WTVPLGRRDSATASRAKPNKDLPEPDNLFDTIFLRFSNEGLNLTDLVALSGSHTIGFSRCTSFRQRLYNQSGSGSPDTTLEKSYAAILRQRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGKISPLTGSSGEIRKKCRKINN 336          
The following BLAST results are available for this feature:
BLAST of CF831924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
PER56_ARATH7.850e-5256.45Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=... [more]
PER3_ARATH3.298e-5052.20Peroxidase 3 OS=Arabidopsis thaliana GN=PER3 PE=1 ... [more]
PER39_ARATH4.308e-5053.20Peroxidase 39 OS=Arabidopsis thaliana GN=PER39 PE=... [more]
PER27_ARATH2.792e-4953.20Peroxidase 27 OS=Arabidopsis thaliana GN=PER27 PE=... [more]
PER1_ORYSJ8.124e-4953.14Peroxidase 1 OS=Oryza sativa subsp. japonica GN=PR... [more]
PER30_ARATH1.532e-4752.43Peroxidase 30 OS=Arabidopsis thaliana GN=PER30 PE=... [more]
PER24_ARATH7.604e-4751.22Peroxidase 24 OS=Arabidopsis thaliana GN=PER24 PE=... [more]
PER1_ARATH7.868e-4447.32Peroxidase 1/2 OS=Arabidopsis thaliana GN=PER1 PE=... [more]
PER5_VITVI3.202e-3744.12Peroxidase 5 OS=Vitis vinifera GN=GSVIVT0003715900... [more]
PER14_ARATH6.039e-3643.35Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A09_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831924 ID=CF831924|Name=CF831924|organism=Citrus sinensis|type=EST|length=844bp
TTTTTTTTTTTTTTTTTAACCCAGTCAAATTAATTCCCTTAAAAAGGGAG
CTGGTAGTTATAAACGTACAGCCTATCAATGATACAAATTAAGGCTTCAG
CTGCACAAACACACCCACATCCTTAATTTATTCCGGGGTACAATTATCAA
CAGATCTTAACAAACCCACAAGCCCAGCAGCAGACTAAATTGGCAATTAC
ATTGACATCAGATAGATGAATGCAACAAACTATCTGGATTATTAATAACA
CTGCACTTCTTTCGAATCTCCCCTTGAGTGCCAGTGAGAACATTCATAGC
TCCCATTCTCTTCATTGACTGAGCAAACTCGGGGAAAAACTTATCTTGGT
TTCTCAACTCCATGACAATGTTTCTTGCTCCCTTATTGGTTAAAAGAGCA
GCATCAGATTGGAATAGACCCTTGTTCTCGATAAAAATATCATAGTAATG
GCTGTCGAATTTTCGAAAACTCCCCGGGTCCAATTCGGCAGTAGTCGTTG
TGTCGGCAAGGCTCTTGCATTTGGTTTTTAAGAATGCAGCGTATCGTGGG
TCCAATGAAGGATCTTGATCTCCATTTCCTGTGAAATTGTAAAGCCTGTT
GCTGAAAAAGGTGCAGTGCGAAACTCCGATTGTGTGGCCACCTGAAAGGA
CTACAAGATCTTTGACAGTGAGACCTTTGTCGTTAAAATTTTTCTTGAGT
TCACTGAAGTTGGCAAAAGGTGAAGGAAGCAGCAGATCGGCCTCAGCAGC
TATGGACACACTGCCATCTCTTCTACCGGTGAGCACTTCCCACAGGTCCG
GTTTTTGAAATTGGAATGAAACAGAATCCCTTGTAGCCAATGCT
back to top