CF831926

Overview
NameCF831926
Unique NameCF831926
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length569
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig998 contig Csv1_Contig998:3..571. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG2_ARATH (ATP synthase gamma chain 2, chloroplastic OS=Arabidopsis thaliana GN=ATPC2 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.204e-37
Identity = 80/114 (70.18%), Postives = 93/114 (81.58%), Query Frame = -1
Query:  228 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEALTQ 569
            DE+FRLT  +GK+ V R  +   K E+SPLM FEQDP QILDAMMPLY+NSQILRA QES ASE+A+RM+ MS  TDNA ELKKNL++AYN+ RQ KITGELLEIVAGAEAL +
Sbjct:  272 DEMFRLTSKDGKLAVERTKLEVEKPEISPLMQFEQDPVQILDAMMPLYLNSQILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEALRE 385          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_MAIZE (ATP synthase subunit gamma, chloroplastic OS=Zea mays PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.331e-36
Identity = 77/112 (68.75%), Postives = 91/112 (81.25%), Query Frame = -1
Query:  234 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEAL 569
            DELFRLT  EGK+ V R+ V       SP++ FEQDP QILDA++PLY+NSQILRA QES ASE+AARMS MS  TDNA EL+KNLS+AYN++RQ KITGE+LEIVAGA+AL
Sbjct:  246 DELFRLTTKEGKLTVEREKVKIETQPFSPVVQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSSATDNAIELRKNLSIAYNRQRQAKITGEILEIVAGADAL 357          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_TOBAC (ATP synthase gamma chain, chloroplastic OS=Nicotiana tabacum GN=ATPC PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.057e-36
Identity = 76/112 (67.86%), Postives = 89/112 (79.46%), Query Frame = -1
Query:  234 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEAL 569
            DE FRLT  EGK+ V RD +     + SP++ FEQDP QILDA++PLY+NSQILRA QES ASE+AARMS MS  TDNA ELKKNLS  YN++RQ KITGE+LEIVAGA+AL
Sbjct:  265 DEFFRLTTKEGKLTVERDIIRTKTTDFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSSATDNATELKKNLSRVYNRQRQAKITGEILEIVAGADAL 376          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_SPIOL (ATP synthase gamma chain, chloroplastic OS=Spinacia oleracea GN=ATPC PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 4.281e-35
Identity = 75/111 (67.57%), Postives = 88/111 (79.28%), Query Frame = -1
Query:  237 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEA 569
            DELFRLT  EGK+ V RD +       SP++ FEQDPAQILDA++PLY+NSQILRA QES ASE+AARM+ MS  TDNA+ELKK LS+ YN+ RQ KITGE+LEIVAGA A
Sbjct:  252 DELFRLTTKEGKLTVERDMIKTETPAFSPILEFEQDPAQILDALLPLYLNSQILRALQESLASELAARMTAMSNATDNANELKKTLSINYNRARQAKITGEILEIVAGANA 362          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG1_ARATH (ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana GN=ATPC1 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 8.074e-34
Identity = 71/111 (63.96%), Postives = 88/111 (79.28%), Query Frame = -1
Query:  237 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEA 569
            DE FRLT  EGK+ V R++      + SP++ FEQDP QILDA++PLY+NSQILRA QES ASE+AARMS MS  +DNA +LKK+LS+ YN++RQ KITGE+LEIVAGA A
Sbjct:  261 DEFFRLTTKEGKLTVERETFRTPTADFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSSASDNASDLKKSLSMVYNRKRQAKITGEILEIVAGANA 371          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_PEA (ATP synthase gamma chain, chloroplastic OS=Pisum sativum GN=ATPC PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 8.355e-31
Identity = 68/108 (62.96%), Postives = 81/108 (75.00%), Query Frame = -1
Query:  246 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAG 569
            DELFRLT  EGK+ V RD +     + SP++ FEQDP QILDA++PLY+NSQILR  QES ASE+AARMS MS   DNA ELK +L+  YN+  Q KITGE+LEIVAG
Sbjct:  262 DELFRLTTKEGKLTVERDVIRSKTVDFSPILQFEQDPVQILDALLPLYLNSQILRPLQESLASELAARMSAMSSAFDNASELKTDLTRVYNRATQAKITGEILEIVAG 369          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_ANAVT (ATP synthase gamma chain OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpG PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.334e-28
Identity = 66/113 (58.41%), Postives = 85/113 (75.22%), Query Frame = -1
Query:  231 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEALT 569
            DE+FRLT   G+  V R +VT     L   M+FEQDP QILD+++PLY+++Q+LRA QES ASE+AARM+ MS  +DNA EL K+LS++YN+ RQ  IT ELLE+V GAEALT
Sbjct:  203 DEIFRLTTRGGQFEVERQTVTTQARPLPRDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAMSNASDNAGELIKSLSLSYNKARQAAITQELLEVVGGAEALT 315          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_NOSP7 (ATP synthase gamma chain OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpG PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.972e-28
Identity = 64/113 (56.64%), Postives = 84/113 (74.34%), Query Frame = -1
Query:  231 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEALT 569
            DE+FRLT   GK  V R+ V      L+P M+FEQDP QILD+++PLY+++Q+LRA QES ASE+AARM+ MS  ++NA EL   L+++YN+ RQ  IT ELLE+V GAEALT
Sbjct:  203 DEIFRLTTRGGKFEVEREKVASQVRPLAPDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAMSNASENAGELINTLTLSYNKARQAAITQELLEVVGGAEALT 315          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_CHLRE (ATP synthase gamma chain, chloroplastic OS=Chlamydomonas reinhardtii GN=ATPC PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.881e-28
Identity = 62/111 (55.86%), Postives = 82/111 (73.87%), Query Frame = -1
Query:  237 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEA 569
            DE+F+LT   G+  V R+  T     L P ++FEQ+PAQILDA++PLYM+S +LR+ QE+ ASE+AARM+ M+  +DNA ELKK L+V YN++RQ KIT EL EIV GA A
Sbjct:  245 DEIFKLTTKGGEFAVEREKTTIETEALDPSLIFEQEPAQILDALLPLYMSSCLLRSLQEALASELAARMNAMNNASDNAKELKKGLTVQYNKQRQAKITQELAEIVGGAAA 355          
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_ANASP (ATP synthase gamma chain OS=Anabaena sp. (strain PCC 7120) GN=atpG PE=3 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 3.881e-28
Identity = 65/113 (57.52%), Postives = 85/113 (75.22%), Query Frame = -1
Query:  231 DELFRLTPNEGKMIVARDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEALT 569
            DE+FRLT   G+  V R +VT     L   M+FEQDP QILD+++PLY+++Q+LRA QES ASE+AARM+ MS  ++NA EL K+LS++YN+ RQ  IT ELLE+V GAEALT
Sbjct:  203 DEIFRLTTRGGQFQVERQTVTSQARPLPRDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAMSNASENAGELIKSLSLSYNKARQAAITQELLEVVGGAEALT 315          
The following BLAST results are available for this feature:
BLAST of CF831926 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 412
Match NameE-valueIdentityDescription
ATPG2_ARATH1.204e-3770.18ATP synthase gamma chain 2, chloroplastic OS=Arabi... [more]
ATPG_MAIZE1.331e-3668.75ATP synthase subunit gamma, chloroplastic OS=Zea m... [more]
ATPG_TOBAC5.057e-3667.86ATP synthase gamma chain, chloroplastic OS=Nicotia... [more]
ATPG_SPIOL4.281e-3567.57ATP synthase gamma chain, chloroplastic OS=Spinaci... [more]
ATPG1_ARATH8.074e-3463.96ATP synthase gamma chain 1, chloroplastic OS=Arabi... [more]
ATPG_PEA8.355e-3162.96ATP synthase gamma chain, chloroplastic OS=Pisum s... [more]
ATPG_ANAVT1.334e-2858.41ATP synthase gamma chain OS=Anabaena variabilis (s... [more]
ATPG_NOSP72.972e-2856.64ATP synthase gamma chain OS=Nostoc punctiforme (st... [more]
ATPG_CHLRE3.881e-2855.86ATP synthase gamma chain, chloroplastic OS=Chlamyd... [more]
ATPG_ANASP3.881e-2857.52ATP synthase gamma chain OS=Anabaena sp. (strain P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A10_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831926 ID=CF831926|Name=CF831926|organism=Citrus sinensis|type=EST|length=569bp
TTTTTTTTTTTTTTTGCCAGAAAAAACAATGCCATTTCTTTTCGTCCCTT
ATACTAGTTTACCATATGAAATACTCAAGTCATCAATACAAATTATAAAC
CAGCGTTCAATGATGAATATACTAACTAGCATATGATGTGAACTGCGATA
TTCTCAACCCCCCCAAACAAAAAAAAGGGATATACAAAAATCAAGTCAAG
GAAAAACAAAGGGTCAAATTAATCAAACTGTGTAAGTGCCTCGGCTCCAG
CAACAATCTCCAATAGTTCACCAGTGATTTTACCCTGGCGTTCTTGGTTA
TAAGCAACTGAAAGATTTTTCTTCAACTCATCAGCATTATCCGTAACAAT
ACTCATGGGACTCATCCTCGCTGCAACCTCACTAGCGAATGACTCCTGGA
ATGCCCTCAAAATCTGACTATTCATATAGAGCGGCATCATCGCATCAAGA
ATCTGAGCCGGATCTTGCTCAAACAGCATAAGAGGCGATAATTCCCCTTT
ATTGAATGTCACGCTATCTCTCGCGACAATCATCTTCCCTTCATTAGGTG
TCAACCTAAACAACTCATC
back to top