CF831927

Overview
NameCF831927
Unique NameCF831927
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length502
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG2_ARATH (ATP synthase gamma chain 2, chloroplastic OS=Arabidopsis thaliana GN=ATPC2 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.982e-22
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            T+ +GK+ VER      K E+SPL  F+Q P QILDAMMPLY+N QILRAL+ES A+E ASRM+AM
Sbjct:  278 TSKDGKLAVERTKLEVEKPEISPLMQFEQDPVQILDAMMPLYLNSQILRALQESLASELASRMNAM 343          

HSP 2 Score: 48.521 bits (114), Expect = 1.982e-22
Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA*ALTQ 346
            KNL++AYN+ RQAKITGELLEIVAGA AL +
Sbjct:  355 KNLTMAYNRARQAKITGELLEIVAGAEALRE 385          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_MAIZE (ATP synthase subunit gamma, chloroplastic OS=Zea mays PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 4.667e-21
Identity = 38/66 (57.58%), Postives = 47/66 (71.21%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT EGK+ VER          SP+  F+Q P QILDA++PLY+N QILRAL+ES A+E A+RMSAM
Sbjct:  252 TTKEGKLTVEREKVKIETQPFSPVVQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAM 317          

HSP 2 Score: 49.6766 bits (117), Expect = 4.667e-21
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA*AL 340
            KNLS+AYN++RQAKITGE+LEIVAGA AL
Sbjct:  329 KNLSIAYNRQRQAKITGEILEIVAGADAL 357          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_TOBAC (ATP synthase gamma chain, chloroplastic OS=Nicotiana tabacum GN=ATPC PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.463e-20
Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT EGK+ VER        + SP+  F+Q P QILDA++PLY+N QILRAL+ES A+E A+RMSAM
Sbjct:  271 TTKEGKLTVERDIIRTKTTDFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAM 336          

HSP 2 Score: 46.595 bits (109), Expect = 6.463e-20
Identity = 23/29 (79.31%), Postives = 26/29 (89.66%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA*AL 340
            KNLS  YN++RQAKITGE+LEIVAGA AL
Sbjct:  348 KNLSRVYNRQRQAKITGEILEIVAGADAL 376          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG1_ARATH (ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana GN=ATPC1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.422e-19
Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT EGK+ VER        + SP+  F+Q P QILDA++PLY+N QILRAL+ES A+E A+RMSAM
Sbjct:  267 TTKEGKLTVERETFRTPTADFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAM 332          

HSP 2 Score: 44.2838 bits (103), Expect = 1.422e-19
Identity = 20/26 (76.92%), Postives = 25/26 (96.15%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA 331
            K+LS+ YN++RQAKITGE+LEIVAGA
Sbjct:  344 KSLSMVYNRKRQAKITGEILEIVAGA 369          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_SPIOL (ATP synthase gamma chain, chloroplastic OS=Spinacia oleracea GN=ATPC PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.968e-18
Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT EGK+ VER          SP+  F+Q PAQILDA++PLY+N QILRAL+ES A+E A+RM+AM
Sbjct:  258 TTKEGKLTVERDMIKTETPAFSPILEFEQDPAQILDALLPLYLNSQILRALQESLASELAARMTAM 323          

HSP 2 Score: 42.3578 bits (98), Expect = 1.968e-18
Identity = 20/26 (76.92%), Postives = 23/26 (88.46%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA 331
            K LS+ YN+ RQAKITGE+LEIVAGA
Sbjct:  335 KTLSINYNRARQAKITGEILEIVAGA 360          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_PEA (ATP synthase gamma chain, chloroplastic OS=Pisum sativum GN=ATPC PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 8.212e-16
Identity = 37/66 (56.06%), Postives = 47/66 (71.21%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT EGK+ VER        + SP+  F+Q P QILDA++PLY+N QILR L+ES A+E A+RMSAM
Sbjct:  268 TTKEGKLTVERDVIRSKTVDFSPILQFEQDPVQILDALLPLYLNSQILRPLQESLASELAARMSAM 333          

HSP 2 Score: 35.039 bits (79), Expect = 8.212e-16
Identity = 16/24 (66.67%), Postives = 20/24 (83.33%), Query Frame = 2
Query:  257 NLSLAYNQERQAKITGELLEIVAG 328
            +L+  YN+  QAKITGE+LEIVAG
Sbjct:  346 DLTRVYNRATQAKITGEILEIVAG 369          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_CHLRE (ATP synthase gamma chain, chloroplastic OS=Chlamydomonas reinhardtii GN=ATPC PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.692e-15
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT  G+  VER   T     L P  +F+Q PAQILDA++PLYM+  +LR+L+E+ A+E A+RM+AM
Sbjct:  251 TTKGGEFAVEREKTTIETEALDPSLIFEQEPAQILDALLPLYMSSCLLRSLQEALASELAARMNAM 316          

HSP 2 Score: 36.5798 bits (83), Expect = 8.692e-15
Identity = 17/26 (65.38%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA 331
            K L++ YN++RQAKIT EL EIV GA
Sbjct:  328 KGLTVQYNKQRQAKITQELAEIVGGA 353          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_NOSP7 (ATP synthase gamma chain OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpG PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.134e-14
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT  GK  VER         L+P  +F+Q P QILD+++PLY++ Q+LRAL+ES A+E A+RM+AM
Sbjct:  209 TTRGGKFEVEREKVASQVRPLAPDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAM 274          

HSP 2 Score: 38.1206 bits (87), Expect = 1.134e-14
Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 2
Query:  260 LSLAYNQERQAKITGELLEIVAGA*ALT 343
            L+L+YN+ RQA IT ELLE+V GA ALT
Sbjct:  288 LTLSYNKARQAAITQELLEVVGGAEALT 315          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_ANAVT (ATP synthase gamma chain OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpG PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.134e-14
Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT  G+  VER   T     L    +F+Q P QILD+++PLY++ Q+LRAL+ES A+E A+RM+AM
Sbjct:  209 TTRGGQFEVERQTVTTQARPLPRDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAM 274          

HSP 2 Score: 41.5874 bits (96), Expect = 1.134e-14
Identity = 21/30 (70.00%), Postives = 25/30 (83.33%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA*ALT 343
            K+LSL+YN+ RQA IT ELLE+V GA ALT
Sbjct:  286 KSLSLSYNKARQAAITQELLEVVGGAEALT 315          
BLAST of CF831927 vs. ExPASy Swiss-Prot
Match: ATPG_ANASP (ATP synthase gamma chain OS=Anabaena sp. (strain PCC 7120) GN=atpG PE=3 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 1.134e-14
Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = 3
Query:   21 TTIEGKMIVERPNETFNKGELSPLKLFDQYPAQILDAMMPLYMNRQILRALRESFATEDASRMSAM 218
            TT  G+  VER   T     L    +F+Q P QILD+++PLY++ Q+LRAL+ES A+E A+RM+AM
Sbjct:  209 TTRGGQFQVERQTVTSQARPLPRDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAM 274          

HSP 2 Score: 41.5874 bits (96), Expect = 1.134e-14
Identity = 21/30 (70.00%), Postives = 25/30 (83.33%), Query Frame = 2
Query:  254 KNLSLAYNQERQAKITGELLEIVAGA*ALT 343
            K+LSL+YN+ RQA IT ELLE+V GA ALT
Sbjct:  286 KSLSLSYNKARQAAITQELLEVVGGAEALT 315          
The following BLAST results are available for this feature:
BLAST of CF831927 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
ATPG2_ARATH1.982e-2262.12ATP synthase gamma chain 2, chloroplastic OS=Arabi... [more]
ATPG_MAIZE4.667e-2157.58ATP synthase subunit gamma, chloroplastic OS=Zea m... [more]
ATPG_TOBAC6.463e-2057.58ATP synthase gamma chain, chloroplastic OS=Nicotia... [more]
ATPG1_ARATH1.422e-1957.58ATP synthase gamma chain 1, chloroplastic OS=Arabi... [more]
ATPG_SPIOL1.968e-1857.58ATP synthase gamma chain, chloroplastic OS=Spinaci... [more]
ATPG_PEA8.212e-1656.06ATP synthase gamma chain, chloroplastic OS=Pisum s... [more]
ATPG_CHLRE8.692e-1550.00ATP synthase gamma chain, chloroplastic OS=Chlamyd... [more]
ATPG_NOSP71.134e-1450.00ATP synthase gamma chain OS=Nostoc punctiforme (st... [more]
ATPG_ANAVT1.134e-1448.48ATP synthase gamma chain OS=Anabaena variabilis (s... [more]
ATPG_ANASP1.134e-1448.48ATP synthase gamma chain OS=Anabaena sp. (strain P... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01A10_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831927 ID=CF831927|Name=CF831927|organism=Citrus sinensis|type=EST|length=502bp
GGATGAGTTGCCCTATAAAGACAACTATTGAAGGGAAGATGATTGTCGAG
AGACCTAACGAGACCTTCAATAAAGGGGAATTATCGCCTCTTAAGCTGTT
TGACCAATATCCGGCTCAGATTCTTGATGCAATGATGCCACTCTATATGA
ATAGACAGATTTTGAGGGCATTGCGAGAGTCATTCGCTACTGAGGATGCA
TCGAGGATGAGTGCCATGATGTACTGCTACTGATAATGCTGATGAGTTGA
AATAAAAATCTTTCTCTTGCTTATAACCAAGAACGCCAGGCTAAAATCAC
TGGTGAACTATTGGAGATTGTTGCTGGAGCCTAGGCACTTACACAGGTTG
ATTAATTTGACCCTTTGTTTTTCCTTGACTTGATTTTTCTATATCCCTTT
TTTTTGTTTGGGGGGGTTGATAATATTGCAGTTCACATCATATGCTAGTT
AGTATATTCATCATTGAACGCTGGCTTATAATTGGTATTGATGACTTGAG
TA
back to top