CF831929

Overview
NameCF831929
Unique NameCF831929
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2291 contig Csv1_Contig2291:94..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.631e-57
Identity = 103/120 (85.83%), Postives = 112/120 (93.33%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKT-GWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PPLQHFD+AEPAFLQIAQYRAGIVP+SFRRVPC KKGGIRFT+NGHSYFNLVLI+NVGGAGDVH+VSIKGSKT  WQAMSRNWGQNWQSNSY+N QSLSFQ+T SDGRT+ SN+V P NW
Sbjct:  123 PPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAMSRNWGQNWQSNSYMNDQSLSFQVTTSDGRTLVSNDVAPSNW 242          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 6.853e-56
Identity = 100/119 (84.03%), Postives = 108/119 (90.76%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PP  HFDMAEPAFL IAQYRAGIVP+SFRRVPC KKGG+RFTVNGHSYFNLVL+TNV GAGDV SVSIKGS+TGWQ MSRNWGQNWQSN++L+GQSLSFQ+TASDGRTVTSNNV    W
Sbjct:  117 PPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW 235          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 6.853e-56
Identity = 100/119 (84.03%), Postives = 108/119 (90.76%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PP  HFDMAEPAFL IAQYRAGIVP+SFRRVPC KKGG+RFTVNGHSYFNLVL+TNV GAGDV SVSIKGS+TGWQ MSRNWGQNWQSN++L+GQSLSFQ+TASDGRTVTSNNV    W
Sbjct:  117 PPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW 235          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 1.527e-55
Identity = 99/119 (83.19%), Postives = 105/119 (88.24%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PP  HFDMAEPAFLQI  YRAGIVP+S+RRVPC KKGGIRFT+NGHSYFNLVL+TNV G GDV SVSIKGS TGWQ MSRNWGQNWQSNSYL+GQSLSFQ+  SDGRTVTSNNVVP  W
Sbjct:  122 PPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGW 240          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.377e-54
Identity = 91/119 (76.47%), Postives = 107/119 (89.92%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PP QHFD+++P F +IAQYRAGIVP+++RRVPC ++GGIRFT+NGHSYFNLVLITNVGGAGDVHS  +KGS+TGWQAMSRNWGQNWQSNSYLNGQSLSF++T SDG+T+ SNNV    W
Sbjct:  120 PPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGW 238          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.377e-54
Identity = 93/119 (78.15%), Postives = 107/119 (89.92%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PPL+HFD+A+P F +IAQYRAGIVP+S+RRVPC ++GGIRFT+NGHSYFNLVLITNVGGAGDVHS +IKGS+T WQAMSRNWGQNWQSNSYLNGQ+LSF++T SDGRTV S N  P  W
Sbjct:  119 PPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGW 237          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 3.183e-53
Identity = 88/119 (73.95%), Postives = 109/119 (91.60%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PPL HFD+++P F +IAQY+AG+VP+S+RRVPC ++GGIRFT+NGHSYFNLVL+TNVGGAGDVHSV++KGS+T WQ MSRNWGQNWQSN+ LNGQ+LSF++TASDGRTV SNN+ P +W
Sbjct:  123 PPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASW 241          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXPA2_ARATH (Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 1.747e-51
Identity = 94/120 (78.33%), Postives = 109/120 (90.83%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTG-WQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PPL+HFD+AEPAFLQIAQYRAGIVP++FRRVPC K GGIRFT+NG+ YF+LVLITNVGGAGD+ +VS+KGSKT  WQ+MSRNWGQNWQSN+YL GQSLSFQ+T SDGRTV S +VVP +W
Sbjct:  125 PPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKGGGIRFTINGNPYFDLVLITNVGGAGDIRAVSLKGSKTDQWQSMSRNWGQNWQSNTYLRGQSLSFQVTDSDGRTVVSYDVVPHDW 244          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXP14_ARATH (Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.135e-49
Identity = 87/119 (73.11%), Postives = 103/119 (86.55%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PP  HFD+A+P FL+IAQY+AG+VP+ +RRV C +KGGIRFT+NGHSYFNLVLITNV GAGDV SVSIKG+ T WQ+MSRNWGQNWQSN+ L+GQ+LSF++T SDGRTV SNN  P NW
Sbjct:  122 PPQHHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSMSRNWGQNWQSNAKLDGQALSFKVTTSDGRTVISNNATPRNW 240          
BLAST of CF831929 vs. ExPASy Swiss-Prot
Match: EXP11_ORYSJ (Expansin-A11 OS=Oryza sativa subsp. japonica GN=EXPA11 PE=2 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.060e-48
Identity = 86/119 (72.27%), Postives = 103/119 (86.55%), Query Frame = -3
Query:  267 PPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 623
            PP  HFDMAEPAF +IAQ RAG+VP+ +RRV CAK+GGIRFT+ GHSYFNLVL+TNVGGAGDV +VS+KGS++GWQAMS NWG NWQ+ + L+GQ LSF++TASDGRTVTS+NV P  W
Sbjct:  119 PPRPHFDMAEPAFTRIAQARAGVVPVQYRRVACAKQGGIRFTITGHSYFNLVLVTNVGGAGDVTAVSVKGSRSGWQAMSHNWGANWQNGANLDGQPLSFRVTASDGRTVTSDNVAPSGW 237          
The following BLAST results are available for this feature:
BLAST of CF831929 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
EXPA8_ARATH1.631e-5785.83Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXPA4_ORYSJ6.853e-5684.03Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI6.853e-5684.03Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA2_ORYSJ1.527e-5583.19Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA1_ARATH8.377e-5476.47Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP10_ARATH8.377e-5478.15Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXP15_ARATH3.183e-5373.95Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA2_ARATH1.747e-5178.33Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 ... [more]
EXP14_ARATH2.135e-4973.11Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=... [more]
EXP11_ORYSJ1.060e-4872.27Expansin-A11 OS=Oryza sativa subsp. japonica GN=EX... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A11_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831929 ID=CF831929|Name=CF831929|organism=Citrus sinensis|type=EST|length=625bp
TTTTTTTTGAACGATTTATACCCGTTCATTCAATTGAAGTAATAACTATA
TATCGTACACAATCATTTCTATTTATAGAGGCCTAGCGGGTGCCAACAGA
CCACCACAGCAACAAGACAGGCCACATCGGCCAGGCCTGAGCCTCACCTA
CCCCTATTCTCACCCTTCCTCCCTCACAAACAGTGCCAAATTCAATTAAA
TATACAAATTCTGATTCACTTTTTTAAAATCTAAAACTGACCACCCTCAA
AGGTTTGCCCAAATTGCCAATTTCCAGGCACAACATTGTTGCTAGTCACA
GTCCTGCCGTCACTGGCTGTCAATTGGAAAGAAAGACTTTGGCCGTTAAG
ATAAGAATTGCTCTGCCAATTTTGGCCCCAGTTCCTTGACATTGCTTGCC
ATCCAGTCTTTGAACCCTTGATTGATACTGAATGTACATCTCCTGCTCCT
CCGACATTTGTGATCAAAACCAGGTTGAAGTATGAGTGTCCATTGACGGT
AAACCTTATTCCTCCTTTCTTCGCACACGGGACCCTTCTGAAGGAAATTG
GGACGATACCGGCGCGGTATTGGGCAATTTGCAAGAAAGCGGGCTCAGCC
ATGTCAAAGTGCTGGAGGGGAGGAT
back to top