CF831930

Overview
NameCF831930
Unique NameCF831930
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length812
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6872 contig Csv1_Contig6872:217..1028. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831930 vs. ExPASy Swiss-Prot
Match: RK2_GOSBA (50S ribosomal protein L2, chloroplastic OS=Gossypium barbadense GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 8.214e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -1
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 42.3578 bits (98), Expect = 8.214e-13
Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = -2
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WG+ AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGHPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831930 vs. ExPASy Swiss-Prot
Match: RK2_PEA (50S ribosomal protein L2, chloroplastic OS=Pisum sativum GN=rpl2 PE=3 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 2.338e-12
Identity = 23/36 (63.89%), Postives = 26/36 (72.22%), Query Frame = -1
Query:  126 KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 233
            K P VRGVVMN +D+ H GG+GR  I RKK STP G
Sbjct:  213 KRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPSTPWG 248          

HSP 2 Score: 42.743 bits (99), Expect = 2.338e-12
Identity = 19/28 (67.86%), Postives = 22/28 (78.57%), Query Frame = -2
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RR+RK NKY+DNLIL
Sbjct:  241 KKPSTPWGYPALGRRTRKSNKYSDNLIL 268          
BLAST of CF831930 vs. ExPASy Swiss-Prot
Match: RK2_JASNU (50S ribosomal protein L2, chloroplastic OS=Jasminum nudiflorum GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 2.451e-11
Identity = 22/36 (61.11%), Postives = 26/36 (72.22%), Query Frame = -1
Query:  126 KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 233
            K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  214 KRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPTTPWG 249          

HSP 2 Score: 40.4318 bits (93), Expect = 2.451e-11
Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = -2
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL  RSRK+NKY++NLIL
Sbjct:  242 KKPTTPWGYPALGSRSRKRNKYSENLIL 269          
BLAST of CF831930 vs. ExPASy Swiss-Prot
Match: RK2_EPIVI (50S ribosomal protein L2, plastid OS=Epifagus virginiana GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.182e-11
Identity = 23/36 (63.89%), Postives = 26/36 (72.22%), Query Frame = -1
Query:  126 KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 233
            K P VRGVVMN ID+ H GG+GR  I RKK +TP G
Sbjct:  214 KRPVVRGVVMNPIDHPHGGGEGRAPIGRKKPTTPWG 249          

HSP 2 Score: 39.6614 bits (91), Expect = 3.182e-11
Identity = 18/28 (64.29%), Postives = 21/28 (75.00%), Query Frame = -2
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK NKY+DN I+
Sbjct:  242 KKPTTPWGYPALGRRSRKINKYSDNFIV 269          
The following BLAST results are available for this feature:
BLAST of CF831930 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RK2_GOSBA8.214e-1360.0050S ribosomal protein L2, chloroplastic OS=Gossypi... [more]
RK2_PEA2.338e-1263.8950S ribosomal protein L2, chloroplastic OS=Pisum s... [more]
RK2_JASNU2.451e-1161.1150S ribosomal protein L2, chloroplastic OS=Jasminu... [more]
RK2_EPIVI3.182e-1163.8950S ribosomal protein L2, plastid OS=Epifagus virg... [more]
back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01A12_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831930 ID=CF831930|Name=CF831930|organism=Citrus sinensis|type=EST|length=812bp
GCCCCTTTAGACTATGTCATGTGCATTAAAATTTCGATTTTCTCTCCTAT
TTAATACCTTGGCAAAGAATTAAATTATCATTATATTTATTCTTTTTTCT
GCTTCGTCTTCAAAGTGCAAGATAACCCCAAAGGGGTTGAGGCCTTTTTT
CTACAAATCGATACCCTTCCTTTACCACCCCAATGGAGGTAGTCTATGGA
ATTCATAACTACTCCTCTTACAGCAGGATTCTTGAACCAACAATCAGTTC
AAGAAATTAAAAAAAAGGCAGACCTGAAATAAGAATAGAACTCTCAAGTT
TTGCTTCAAAATATAAATAAGTGAAAACCATAGATTTCAGATTTATTAAT
GAAAGCTATGAGAAAGTTTGGTTTTACACCAGTGCATTATTTAGAGGGTT
CAATGAATGATGATACCCCTCTGTTAATATTGTTGTTACTCTGCAGCTGG
TTTGCTAGTCTCATCCTTGCATCTAGGTTGATGATTGTGATTTTTCAACT
CATCTCCAGCCACAAGAAAGAATGCAGTGTGTCTGAAAAAATTCATCATT
TTGATTTTTGAGTCAGCATCAATTTCTGGGGTACTGTCTAGTGCAATCTG
CATATGATGTAACCATCTCTCTGCAGCTTGATGTGTTACTGGGAATGGTC
GATGACGTCCAATTAATGCAGGATGGCCTTTCCTCTGAGAATACAGAGGA
GGCCCTCCCATTCTCTGCACAAAAAACTCATATTGGTTCTGAATTGCTTC
TTCTTTATTCGAATTTGCAAAAATTGACCTAAACCACTCTTCCTCGTCGT
CATAAACCCTGG
back to top