CF831931

Overview
NameCF831931
Unique NameCF831931
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2291 contig Csv1_Contig2291:93..795. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.130e-71
Identity = 123/145 (84.83%), Postives = 134/145 (92.41%), Query Frame = -2
Query:  268 SIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKT-GWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 699
            +I VTATNFCPPN  LSNDNGGWCNPPLQHFD+AEPAFLQIAQYRAGIVP+SFRR+PC KKGGIRFT+NGHSYFNLVLI+NVGGAGDVH+VSIKGSKT  WQAMSRNWGQNWQSNSY+N QSLSFQ+T SDGRT+ SN+V P NW
Sbjct:   98 TITVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAMSRNWGQNWQSNSYMNDQSLSFQVTTSDGRTLVSNDVAPSNW 242          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.381e-69
Identity = 119/145 (82.07%), Postives = 130/145 (89.66%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            GSI VTATNFCPPN  L +D+GGWCNPP  HFDMAEPAFL IAQYRAGIVP+SFRR+PC KKGG+RFTVNGHSYFNLVL+TNV GAGDV SVSIKGS+TGWQ MSRNWGQNWQSN++L+GQSLSFQ+TASDGRTVTSNNV    W
Sbjct:   91 GSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW 235          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.381e-69
Identity = 119/145 (82.07%), Postives = 130/145 (89.66%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            GSI VTATNFCPPN  L +D+GGWCNPP  HFDMAEPAFL IAQYRAGIVP+SFRR+PC KKGG+RFTVNGHSYFNLVL+TNV GAGDV SVSIKGS+TGWQ MSRNWGQNWQSN++L+GQSLSFQ+TASDGRTVTSNNV    W
Sbjct:   91 GSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW 235          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 1.804e-69
Identity = 118/145 (81.38%), Postives = 127/145 (87.59%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            GS+ VTATN CPPN AL ND+GGWCNPP  HFDMAEPAFLQI  YRAGIVP+S+RR+PC KKGGIRFT+NGHSYFNLVL+TNV G GDV SVSIKGS TGWQ MSRNWGQNWQSNSYL+GQSLSFQ+  SDGRTVTSNNVVP  W
Sbjct:   96 GSVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGW 240          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 5.249e-69
Identity = 114/145 (78.62%), Postives = 132/145 (91.03%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            GSI+VTATNFCPPN AL+N+NGGWCNPPL+HFD+A+P F +IAQYRAGIVP+S+RR+PC ++GGIRFT+NGHSYFNLVLITNVGGAGDVHS +IKGS+T WQAMSRNWGQNWQSNSYLNGQ+LSF++T SDGRTV S N  P  W
Sbjct:   93 GSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGW 237          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.579e-68
Identity = 111/145 (76.55%), Postives = 130/145 (89.66%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            GSI+VTATNFCPPN AL N+ GGWCNPP QHFD+++P F +IAQYRAGIVP+++RR+PC ++GGIRFT+NGHSYFNLVLITNVGGAGDVHS  +KGS+TGWQAMSRNWGQNWQSNSYLNGQSLSF++T SDG+T+ SNNV    W
Sbjct:   94 GSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGW 238          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA2_ARATH (Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 2.880e-67
Identity = 116/146 (79.45%), Postives = 134/146 (91.78%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTG-WQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            GSIIV+ATNFCPPN AL+NDNGGWCNPPL+HFD+AEPAFLQIAQYRAGIVP++FRR+PC K GGIRFT+NG+ YF+LVLITNVGGAGD+ +VS+KGSKT  WQ+MSRNWGQNWQSN+YL GQSLSFQ+T SDGRTV S +VVP +W
Sbjct:   99 GSIIVSATNFCPPNFALANDNGGWCNPPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKGGGIRFTINGNPYFDLVLITNVGGAGDIRAVSLKGSKTDQWQSMSRNWGQNWQSNTYLRGQSLSFQVTDSDGRTVVSYDVVPHDW 244          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 254.218 bits (648), Expect = 4.913e-67
Identity = 108/145 (74.48%), Postives = 132/145 (91.03%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            G+IIVTATNFCPPN AL N+ GGWCNPPL HFD+++P F +IAQY+AG+VP+S+RR+PC ++GGIRFT+NGHSYFNLVL+TNVGGAGDVHSV++KGS+T WQ MSRNWGQNWQSN+ LNGQ+LSF++TASDGRTV SNN+ P +W
Sbjct:   97 GAIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASW 241          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.136e-62
Identity = 104/144 (72.22%), Postives = 125/144 (86.81%), Query Frame = -2
Query:  268 SIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 699
            SI++TATNFCPPNLA  +DNGGWCNPP +HFD+A P FL+IAQYRAGIVP+S+RR+PC K+GGIRFT+NGH YFNLVLITNV GAGD+   S+KGS+TGW ++SRNWGQNWQSN+ L GQ+LSF++T SD RT TS N+VP NW
Sbjct:  101 SILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSNW 244          
BLAST of CF831931 vs. ExPASy Swiss-Prot
Match: EXP14_ARATH (Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.758e-62
Identity = 104/145 (71.72%), Postives = 124/145 (85.52%), Query Frame = -2
Query:  268 GSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNW 702
            G+I VT TNFCPPN A +N+ GGWCNPP  HFD+A+P FL+IAQY+AG+VP+ +RR+ C +KGGIRFT+NGHSYFNLVLITNV GAGDV SVSIKG+ T WQ+MSRNWGQNWQSN+ L+GQ+LSF++T SDGRTV SNN  P NW
Sbjct:   96 GTITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSMSRNWGQNWQSNAKLDGQALSFKVTTSDGRTVISNNATPRNW 240          
The following BLAST results are available for this feature:
BLAST of CF831931 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
EXPA8_ARATH1.130e-7184.83Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXPA4_ORYSJ1.381e-6982.07Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI1.381e-6982.07Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA2_ORYSJ1.804e-6981.38Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP10_ARATH5.249e-6978.62Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXPA1_ARATH7.579e-6876.55Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXPA2_ARATH2.880e-6779.45Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 ... [more]
EXP15_ARATH4.913e-6774.48Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA4_ARATH2.136e-6272.22Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXP14_ARATH4.758e-6271.72Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01A12_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831931 ID=CF831931|Name=CF831931|organism=Citrus sinensis|type=EST|length=703bp
TTTTTTTTGAACGATATTATACCCGTTCATTCAATTGAAGTAATAACTAT
ATATCTAACACAATCATTTCTATTTATAGAGGCCTAGCGGGTGCCAACAG
ACCACCACAGCAACAAGACAGGCCACATCGGCCAGGCCTGAGCCTCACCT
ACCCCTATTCTCACCCTTCCTCCCTCACAAACAGTGCCAAATTCAATTAA
ATATACAAATTCTGATTCACTTTTTTAAAATCTAAAACTGACCACCCTCA
AAGGTTTGCCCAAATTGCCAATTTCCAGGCACAACATTGTTGCTAGTCAC
AGTCCTGCCGTCACTGGCTGTCAATTGGAAAGAAAGACTTTGGCCGTTAA
GATAAGAATTGCTCTGCCAATTTTGGCCCCAGTTCCTTGACATTGCTTGC
CATCCAGTCTTTGAACCCTTGATTGATACTGAATGTACATCTCCTGCTCC
TCCGACATTTGTGATCAAAACCAGGTTGAAGTATGAGTGTCCATTGACGG
TAAACCTTATTCCTCCTTTCTTCGCACACGGGATCCTTCTGAAGGAAATT
GGGACGATACCGGCGCGGTATTGGGCAATTTGCAAGAAAGCGGGCTCAGC
CATGTCAAAGTGCTGGAGGGGAGGATTGCACCAACCGCCGTTGTCGTTAG
ACAGGGCAAGGTTAGGTGGGCAGAAGTTGGTGGCGGTGACAATGATGGAG
CCG
back to top