CF832077

Overview
NameCF832077
Unique NameCF832077
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length746
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5674 contig Csv1_Contig5674:25..770. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832077 vs. ExPASy Swiss-Prot
Match: PSAG_ARATH (Photosystem I reaction center subunit V, chloroplastic OS=Arabidopsis thaliana GN=PSAG PE=1 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.580e-58
Identity = 113/157 (71.97%), Postives = 133/157 (84.71%), Query Frame = 2
Query:  161 ASSSLFTPSTITVRKHQISPSSISFQGLRPLNTR-AKTPLPKLATSAKRNSFGGIKAELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKFFG 628
            ++S+L +P+T +      +P+SISF GLRPL    + + LPKL+T+ +++S   ++AEL+  +VISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNG THFEAGD RAKEYVSLLKSNDP+GFNIVDVLAWGSIGHIVAYYILATSSNGYDP FFG
Sbjct:    4 SASALLSPTTFSTAISHKNPNSISFHGLRPLRLGGSSSALPKLSTTGRKSSSAVVRAELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYVSLLKSNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGYDPSFFG 160          
BLAST of CF832077 vs. ExPASy Swiss-Prot
Match: PSAG_SPIOL (Photosystem I reaction center subunit V, chloroplastic OS=Spinacia oleracea GN=PSAG PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 9.607e-48
Identity = 101/134 (75.37%), Postives = 111/134 (82.84%), Query Frame = 2
Query:  230 SFQGLRPL--NTRAKTPLPKLATSAKRNSFGGIKAELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKFF 625
            SF GLRPL  N  +      L+ S+ R S    +AEL+  LVISLSTGLSLFLGRFVFFNFQREN+AKQ +PEQNG++HFEAGD RAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILAT+SNGYDP FF
Sbjct:   36 SFSGLRPLKLNISSNNSSSSLSMSSARRSMT-CRAELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQ-VPEQNGMSHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF 167          
BLAST of CF832077 vs. ExPASy Swiss-Prot
Match: PSAG_HORVU (Photosystem I reaction center subunit V, chloroplastic OS=Hordeum vulgare GN=PSAG PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.708e-42
Identity = 91/139 (65.47%), Postives = 108/139 (77.70%), Query Frame = 2
Query:  212 ISPSSISFQGLRPLNTRAKTPLPKLATSAKRNSFGGIKAELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKFFG 628
            +SP +++   L P + RA      ++  A+R+     +A L   +VISLSTGLSL +GRFVFFNFQRENVAKQ +PEQNG THFEAGD RAKE+  +LKSNDPVGFN+VDVLAWGSIGHIVAYYILAT+SNGYDP FFG
Sbjct:    9 LSPPAVAGLRLAP-SPRAAASFRGVSPPARRSV--AARAALEPSVVISLSTGLSLVMGRFVFFNFQRENVAKQ-VPEQNGKTHFEAGDERAKEFAGILKSNDPVGFNLVDVLAWGSIGHIVAYYILATTSNGYDPPFFG 143          
BLAST of CF832077 vs. ExPASy Swiss-Prot
Match: PSAG_TORRU (Photosystem I reaction center subunit V, chloroplastic OS=Tortula ruralis GN=PSAG PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.065e-22
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  335 NTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYD 613
            NT  +IS ST   L LGRFVF  FQR  V++ GLPEQNGV          + + S+LK+NDP GF +VDVLAWG++GH V ++ILAT++NGY+
Sbjct:   17 NTSFIISASTAALLALGRFVFLPFQRSMVSRHGLPEQNGVPTTRRVTAVRRRWWSMLKTNDPAGFTLVDVLAWGALGHAVGFFILATATNGYN 109          
BLAST of CF832077 vs. ExPASy Swiss-Prot
Match: PSAG_PEA (Photosystem I reaction center subunit V (Fragment) OS=Pisum sativum GN=PSAG PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.683e-13
Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 2
Query:  329 ELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQ 445
            ELN  LVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQ
Sbjct:    1 ELNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQ 39          
BLAST of CF832077 vs. ExPASy Swiss-Prot
Match: PSAG_CHLRE (Photosystem I reaction center subunit V, chloroplastic OS=Chlamydomonas reinhardtii GN=PSAG PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.109e-11
Identity = 39/95 (41.05%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  323 KAELNTPLVISLSTGLSLFLGRFVFFNFQRE--NVAKQGLPEQNGVTHFEAGDVRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSS 601
            KA L+  +VIS ST   L +GRFVF  +QR   N      P+  G T+F+  D++     ++  +NDP GFNI+DV  WG++GH V + +LA +S
Sbjct:   29 KAALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFD--DLQKNS--TIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINS 119          
The following BLAST results are available for this feature:
BLAST of CF832077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PSAG_ARATH1.580e-5871.97Photosystem I reaction center subunit V, chloropla... [more]
PSAG_SPIOL9.607e-4875.37Photosystem I reaction center subunit V, chloropla... [more]
PSAG_HORVU2.708e-4265.47Photosystem I reaction center subunit V, chloropla... [more]
PSAG_TORRU4.065e-2253.76Photosystem I reaction center subunit V, chloropla... [more]
PSAG_PEA7.683e-1394.87Photosystem I reaction center subunit V (Fragment)... [more]
PSAG_CHLRE1.109e-1141.05Photosystem I reaction center subunit V, chloropla... [more]
back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01E10_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832077 ID=CF832077|Name=CF832077|organism=Citrus sinensis|type=EST|length=746bp
GACGATGTGATCCATATCTGTGTTTCTATCGCCGCTAAGCCTGTCCTATT
TCTTGCAAAAATTTATCATAATCCAGGAACTCAAAAACTCCATCATCCAT
CAAGGCATCAACCAGAACACAAAAAAGAAGGAAAAAGAGGGGAAAAAAAG
AAAAATGGCAGCCTCATCCTCCTTGTTCACACCCTCCACCATCACCGTCC
GAAAACACCAAATTTCACCCTCCAGCATCTCATTCCAAGGCCTAAGACCC
CTCAACACCAGGGCCAAAACCCCCCTCCCCAAGCTCGCCACCTCCGCCAA
AAGAAACAGCTTCGGCGGCATTAAAGCTGAGCTGAACACACCACTTGTCA
TCAGCCTCAGCACTGGCCTCTCCTTGTTCTTGGGCAGGTTCGTCTTCTTC
AACTTCCAAAGAGAGAACGTGGCCAAACAAGGCTTGCCCGAGCAGAATGG
AGTCACCCACTTTGAAGCCGGTGATGTTCGTGCCAAGGAATATGTTAGCC
TCCTCAAATCCAACGACCCAGTTGGCTTTAACATTGTTGATGTTCTCGCT
TGGGGTTCCATTGGCCATATTGTCGCTTACTACATCTTGGCCACCTCCAG
CAACGGCTATGATCCCAAGTTCTTTGGTTGATTTTGTTATTTGTACTGTC
TCTCTTTTGTCTCTTTTAGTTTCTTAATTTCTCAAGTGTTGCGCTTTGTA
TAGTTAATAAATTTCCTAGCATTTAATGGATGAGACCGATGATGTA
back to top