CF832422

Overview
NameCF832422
Unique NameCF832422
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length510
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1721 contig Csv1_Contig1721:290..798. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana GN=FD2 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 8.592e-36
Identity = 67/81 (82.72%), Postives = 77/81 (95.06%), Query Frame = -3
Query:  266 EINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 508
            E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG+VDQS+QSFLDD+QIGEGFVLTCAAYPTSDVTIETHKEE++
Sbjct:   67 EVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDI 147          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER_BRANA (Ferredoxin OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.914e-35
Identity = 68/81 (83.95%), Postives = 75/81 (92.59%), Query Frame = -3
Query:  266 EINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 508
            E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG VDQS++SFLDDDQI EGFVLTCAAYPTSDVTIETHKEEEL
Sbjct:   15 EVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDVTIETHKEEEL 95          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER3_RAPSA (Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.265e-35
Identity = 66/81 (81.48%), Postives = 76/81 (93.83%), Query Frame = -3
Query:  266 EINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 508
            E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG+VDQS+QSFLDDDQI EGFVLTCAAYPTSDVTIETH+EE++
Sbjct:   15 EVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDVTIETHREEDM 95          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER1_APHFL (Ferredoxin-1 OS=Aphanizomenon flos-aquae PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 7.274e-35
Identity = 65/80 (81.25%), Postives = 76/80 (95.00%), Query Frame = -3
Query:  266 INCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 505
            I+CPDD++ILDAAEEAGLDLPYSCRAGACS+C GK+V+GT+DQS+QSFLDDDQ+  G+VLTC AYPTSDVTIETHKEE+L
Sbjct:   18 IDCPDDTYILDAAEEAGLDLPYSCRAGACSTCAGKLVTGTIDQSDQSFLDDDQVEAGYVLTCVAYPTSDVTIETHKEEDL 97          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER1_PHYES (Ferredoxin-1 OS=Phytolacca esculenta PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.042e-34
Identity = 64/81 (79.01%), Postives = 73/81 (90.12%), Query Frame = -3
Query:  263 INCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEELA 505
            I+CPDD+++LDAAEEAGLDLPYSCRAG+CSSC GKV +GTVDQ +QSFLDDDQI  GFVLTC AYP  DVTIETHKEE++A
Sbjct:   16 IDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCAGKVTAGTVDQEDQSFLDDDQIEAGFVLTCVAYPKGDVTIETHKEEDIA 96          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER1_SYNP6 (Ferredoxin-1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=petF1 PE=1 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 1.792e-33
Identity = 66/80 (82.50%), Postives = 73/80 (91.25%), Query Frame = -3
Query:  266 INCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 505
            I+  DD++ILDAAEE G+DLPYSCRAGACS+C GKVVSGTVDQS+QSFLDDDQI  GFVLTC AYPTSDVTIETHKEE+L
Sbjct:   19 IDVADDTYILDAAEEQGIDLPYSCRAGACSTCAGKVVSGTVDQSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDL 98          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER1_SYNE7 (Ferredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=petF PE=3 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 1.792e-33
Identity = 66/80 (82.50%), Postives = 73/80 (91.25%), Query Frame = -3
Query:  266 INCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 505
            I+  DD++ILDAAEE G+DLPYSCRAGACS+C GKVVSGTVDQS+QSFLDDDQI  GFVLTC AYPTSDVTIETHKEE+L
Sbjct:   19 IDVADDTYILDAAEEQGIDLPYSCRAGACSTCAGKVVSGTVDQSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDL 98          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER1_PHYAM (Ferredoxin-1 OS=Phytolacca americana PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.792e-33
Identity = 63/80 (78.75%), Postives = 73/80 (91.25%), Query Frame = -3
Query:  266 INCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 505
            I+CPDD+++LDAAEEAGLDLPYSCRAG+CSSCTGKV +GTVDQ +QSFLDDDQI  GFVLTC A+P  DVTIETHKEE++
Sbjct:   16 IDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCTGKVTAGTVDQEDQSFLDDDQIEAGFVLTCVAFPKGDVTIETHKEEDI 95          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER_SOLLS (Ferredoxin OS=Solanum lasiocarpum PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.991e-33
Identity = 65/83 (78.31%), Postives = 70/83 (84.34%), Query Frame = -3
Query:  260 EINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEELAG 508
            E NCPDD +ILD AEE G DLPYSCRAGACSSC GK+V G+VDQS+ SFLDDDQIG GFVLTC AYP S+VTIETHKEE L G
Sbjct:   15 EFNCPDDVYILDRAEEEGHDLPYSCRAGACSSCAGKIVDGSVDQSDNSFLDDDQIGGGFVLTCVAYPKSNVTIETHKEEALVG 97          
BLAST of CF832422 vs. ExPASy Swiss-Prot
Match: FER_SCEQU (Ferredoxin OS=Scenedesmus quadricauda PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 5.213e-33
Identity = 65/80 (81.25%), Postives = 71/80 (88.75%), Query Frame = -3
Query:  266 INCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 505
            I CPDD++ILDAAEEAGLDLPYSCRAGACSSC GKV +GTVDQS+QSFLDD Q+  GFVLTC AYPTSD TI THKEE+L
Sbjct:   16 IECPDDTYILDAAEEAGLDLPYSCRAGACSSCAGKVEAGTVDQSDQSFLDDSQMDGGFVLTCVAYPTSDCTIATHKEEDL 95          
The following BLAST results are available for this feature:
BLAST of CF832422 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
FER2_ARATH8.592e-3682.72Ferredoxin-2, chloroplastic OS=Arabidopsis thalian... [more]
FER_BRANA1.914e-3583.95Ferredoxin OS=Brassica napus PE=1 SV=1[more]
FER3_RAPSA3.265e-3581.48Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1[more]
FER1_APHFL7.274e-3581.25Ferredoxin-1 OS=Aphanizomenon flos-aquae PE=1 SV=2[more]
FER1_PHYES8.042e-3479.01Ferredoxin-1 OS=Phytolacca esculenta PE=1 SV=1[more]
FER1_SYNP61.792e-3382.50Ferredoxin-1 OS=Synechococcus sp. (strain ATCC 271... [more]
FER1_SYNE71.792e-3382.50Ferredoxin-1 OS=Synechococcus elongatus (strain PC... [more]
FER1_PHYAM1.792e-3378.75Ferredoxin-1 OS=Phytolacca americana PE=1 SV=1[more]
FER_SOLLS3.991e-3378.31Ferredoxin OS=Solanum lasiocarpum PE=1 SV=1[more]
FER_SCEQU5.213e-3381.25Ferredoxin OS=Scenedesmus quadricauda PE=1 SV=1[more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01N12_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01N12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832422 ID=CF832422|Name=CF832422|organism=Citrus sinensis|type=EST|length=510bp
GGGAGTGCGGACCCCCTTTTTTTTTTTTTTTTATAGAACGGTACCATGTT
CGGATGGGATGANAAACCTCTCCCTCTAGGTACGATGCGCATTCATGGCC
GGGGCAATTACTACAANCTTCTTTGCAACAAGAAATAAAAACACATTACA
AGAATCATTCTCAAATTACTCAATATCCCTTTCAAAGCATTAAAATAATC
AGACAAAACACAACACATAAAAGAGAAGATAATAATGAGATATCAAGAGC
ACATTATTAACCAGCGAGCTCCTCTTCCTTGTGAGTCTCTATAGTAACAT
CACTTGTTGGATAAGCAGCACAAGTGAGAACAAAACCTTCTCCAATTTGA
TCATCATCCAGAAAGCTTTGCTCCGACTGGTCAACGGTTCCAGACACAAC
TTTCCCAGTACAGGAAGAGCAAGCCCCAGCCCTGCATGAGTACGGAAGAT
CAAGCCCAGCTTCTTCAGCAGCATCAAGAATAAACGAGTCATCAGGACAG
TTGATTTCTT
back to top