CF832433

Overview
NameCF832433
Unique NameCF832433
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length739
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_DANRE (Ubiquitin thioesterase OTU1 OS=Danio rerio GN=yod1 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 4.074e-51
Identity = 104/212 (49.06%), Postives = 140/212 (66.04%), Query Frame = 3
Query:   66 YKMEGIIVRRVIPSDNSCLFNAVGYVME---HDKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDAL-AISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            +++  ++ RRV+P+DNSCLF +V YVME   +D   A E+R +IA  VASDP  YSEA LGK+N+EYC+WI+  + WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L  + P    P    QT+F       +      AL+L  E +RK+ +TD   F LRC VCQ G++GQKEA EHA+ TGH NF E
Sbjct:   96 FEVTPVVERRVVPADNSCLFTSVNYVMEGGVYDPACASEMRGLIAQIVASDPTAYSEAVLGKTNEEYCTWIRRDDTWGGAIEVSILSKFYQCEICVVDTQTVRVDRFGEDAGYTKRVLLIYDGIHYDPLQKVLPGSDVPA---QTVFSTVDDVILAQ----ALELADEARRKRQFTDVNRFALRCMVCQTGLVGQKEAREHAKETGHTNFGE 300          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_DICDI (Ubiquitin thioesterase OTU1 OS=Dictyostelium discoideum GN=yod1 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.321e-51
Identity = 106/208 (50.96%), Postives = 140/208 (67.31%), Query Frame = 3
Query:   78 GIIVRRVIPSDNSCLFNAVGYVMEHDKN--KAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQEYR 695
            G   RRV   DNSCLF+AV YV+E DKN  K   LR +IA  V SDP +Y+EA LGKSN+ YC+WIQ+P+ WGGAIELSIL+++Y  EIAA+DI T     YG+++KY+ERV LIYDG+HYDAL+I   +  PE+FD T F V    ++   +     L++++ +   +TDTA F+L C  C   + G+KEA  HA  TGH NF EY+
Sbjct:  121 GYATRRVTDDDNSCLFSAVAYVLE-DKNRLKGYSLRALIAQNVKSDPFEYNEAVLGKSNEGYCNWIQNPKNWGGAIELSILSNHYKVEIAAFDISTQLMYCYGEDRKYTERVYLIYDGIHYDALSICLTKNGPEDFDITRFSVDDKDSLAKMK----VLIEKEFKAGKFTDTAKFSLICLNCNKTLKGEKEAAIHASTTGHGNFTEYK 323          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_CHICK (Ubiquitin thioesterase OTU1 OS=Gallus gallus GN=YOD1 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.683e-50
Identity = 105/207 (50.72%), Postives = 134/207 (64.73%), Query Frame = 3
Query:   81 IIVRRVIPSDNSCLFNAVGYVME---HDKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAIS-PFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            ++ RRV+P+DNSCLF +V YV+E   +D   APE+R +IA  VASDP  Y EA LGK+N+EYC WI+  E WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L    P    P    QTIF       +      AL+L  E +RK+ +TD   FTLRC VCQ G+ GQ EA EHA+ TGH NF E
Sbjct:  102 VLARRVVPADNSCLFTSVYYVVEGGVYDPGCAPEMRSLIAQIVASDPEAYCEAVLGKTNREYCEWIRREETWGGAIEVSILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLERKIPDSDVP---PQTIFSTTDDVVLAQ----ALELADEARRKRQFTDVNRFTLRCMVCQKGLTGQVEAREHAKETGHTNFGE 301          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_HUMAN (Ubiquitin thioesterase OTU1 OS=Homo sapiens GN=YOD1 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.733e-47
Identity = 101/206 (49.03%), Postives = 135/206 (65.53%), Query Frame = 3
Query:   81 IIVRRVIPSDNSCLFNAVGYVMEH---DKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            ++ R V+P+DNSCLF +V YV+E    +   APE+R++IA  VASDP  YSEA LGK+NQEYC WI+  + WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L  +  +  P+    TIF       +      AL+L  E +R++ +TD   FTLRC VCQ G+ GQ EA EHA+ TGH NF E
Sbjct:  148 VLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPD--PDTPPLTIFSSNDDIVLVQ----ALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGE 347          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_MOUSE (Ubiquitin thioesterase OTU1 OS=Mus musculus GN=Yod1 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.088e-47
Identity = 98/206 (47.57%), Postives = 135/206 (65.53%), Query Frame = 3
Query:   81 IIVRRVIPSDNSCLFNAVGYVMEH---DKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            ++ R  +P+DNSCLF +V YV+E    +   APE+R++IA  VASDPV YSEA LGK+N++YC WI+  + WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L  +  +  P+    TIF       +      AL+L  E +RK+ +TD   FTLRC +CQ G+ GQ EA +HA+ TGH NF E
Sbjct:  143 VLTRTAVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPVLYSEAILGKTNEDYCDWIRRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPD--PDTPPLTIFSSNDDIVLVQ----ALELADEARRKRQFTDVNRFTLRCMICQKGLTGQAEARDHARETGHTNFGE 342          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_DROME (Ubiquitin thioesterase OTU1 OS=Drosophila melanogaster GN=CG4603 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.313e-46
Identity = 93/206 (45.15%), Postives = 133/206 (64.56%), Query Frame = 3
Query:   78 GIIVRRVIPSDNSCLFNAVGYVMEH--DKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            GI++++V+P+DNSCLF ++ +V+    D   +  +R +IA  VA+DP  Y++A LGKSN EYC+WIQ  + WGGAIE+SIL++YYG EI   DIQ    + +G++K +  RV L++DG+HYD L +   E +P     TIFPV++      AE LA     E Q  + YT+   FTLRC  C + ++GQ +A EHA+ TGH NF E
Sbjct:  148 GILLKKVVPADNSCLFTSIRFVLNGKVDNEGSEMMRHIIAQEVAADPQSYNDAVLGKSNAEYCAWIQKADSWGGAIEVSILSNYYGIEIDVVDIQNAIINRFGEDKNFGLRVFLLFDGIHYDPLYM---ETSPSAAPATIFPVEELGVYQQAEQLA----NEAQSSRQYTNVDKFTLRCMQCDVRLVGQVQAQEHAKQTGHKNFGE 346          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_RAT (Ubiquitin thioesterase OTU1 OS=Rattus norvegicus GN=Yod1 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.021e-46
Identity = 98/206 (47.57%), Postives = 134/206 (65.05%), Query Frame = 3
Query:   81 IIVRRVIPSDNSCLFNAVGYVMEH---DKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            ++ R  +P+DNSCLF +V YV+E    +   APE+R++IA  VASDP  YSEA LGK+N+EYC WI+  + WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L  +  +  P+    TIF       +      AL+L  E +RK+ +TD   FTLRC +CQ G+ GQ EA +HA+ TGH NF E
Sbjct:  143 VLTRTAVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDLYSEAILGKTNEEYCDWIRRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPD--PDTPPLTIFSSNDDIVLVQ----ALELADEARRKRQFTDVNRFTLRCMLCQKGLTGQAEARDHARETGHTNFGE 342          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_BOVIN (Ubiquitin thioesterase OTU1 OS=Bos taurus GN=YOD1 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.731e-46
Identity = 98/206 (47.57%), Postives = 132/206 (64.08%), Query Frame = 3
Query:   81 IIVRRVIPSDNSCLFNAVGYVMEH---DKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            ++ R  +P+DNSCLF +V YV+E    +   APE+R+ IA  VASDP  YSEA LGK+N+EYC WI+  + WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L +      P+    TIF       +      AL+L  E ++K+ +TD   FTLRC VCQ G+ GQ EA +HA+ TGH NF E
Sbjct:  148 VLARMAVPADNSCLFTSVYYVVEGGVLNPACAPEMRRFIAQIVASDPDFYSEAILGKTNEEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLHL--VFPDPDTPPLTIFSSYDDIVLVQ----ALELADEARKKRQFTDVNRFTLRCMVCQKGLTGQAEARDHAKETGHTNFGE 347          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_XENLA (Ubiquitin thioesterase OTU1 OS=Xenopus laevis GN=yod1 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 9.720e-45
Identity = 96/205 (46.83%), Postives = 131/205 (63.90%), Query Frame = 3
Query:   84 IVRRVIPSDNSCLFNAVGYVME---HDKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            IVRRV+P+DNSCLF ++ YV+E   +D   A E+R +IA  VASD   Y +A LGKSN+EYCSWI+  + WGGAIE+SIL+ +Y  EI   D QT R D +G++  Y++RV+LIYDG+HYD L     +  P+    T+F      T   A   A++L  + ++K+ +TD   F LRC  CQ G+ GQ  A +HA+ TGH NF E
Sbjct:  105 IVRRVVPADNSCLFTSIYYVVEGGVYDPACALEMRSLIAEIVASDQSAYCDAVLGKSNEEYCSWIRREDTWGGAIEVSILSKFYQCEICVVDTQTVRIDRFGEDSGYTKRVLLIYDGIHYDPLQRQFPD--PDMPPMTVF----STTDDEALVQAMELADDARKKRQFTDVNQFALRCMACQKGLTGQSAARDHAKETGHTNFGE 303          
BLAST of CF832433 vs. ExPASy Swiss-Prot
Match: OTU1_DROPS (Ubiquitin thioesterase OTU1 OS=Drosophila pseudoobscura pseudoobscura GN=GA18292 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.127e-43
Identity = 86/206 (41.75%), Postives = 132/206 (64.08%), Query Frame = 3
Query:   78 GIIVRRVIPSDNSCLFNAVGYVMEH--DKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQE 689
            GI++++V+P+DNSCLF ++ +V+    D   +  +R +IA  V++D  +Y++A LGKSN +YC+WIQ  + WGGAIE+SIL++YYG EI   DIQ    + +G++K +  RV L++DG+HYD L +   E        TIFPV++      AE +A     E +  + +T+   FTLRC  C + ++GQ +A EHA+ TGH NF+E
Sbjct:  159 GILLKKVVPADNSCLFTSIRFVLNGKVDNEGSEMMRHIIAQEVSADTQQYNDAVLGKSNSDYCAWIQKADSWGGAIEVSILSNYYGIEIDVVDIQNAIINRFGEDKNFGLRVFLLFDGIHYDPLYM---ETQQNSVPATIFPVEEMGVYQQAEQIA----NEAKSSRQFTNVDKFTLRCMDCDVMLVGQGQAQEHAKKTGHENFEE 357          
The following BLAST results are available for this feature:
BLAST of CF832433 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
OTU1_DANRE4.074e-5149.06Ubiquitin thioesterase OTU1 OS=Danio rerio GN=yod1... [more]
OTU1_DICDI5.321e-5150.96Ubiquitin thioesterase OTU1 OS=Dictyostelium disco... [more]
OTU1_CHICK7.683e-5050.72Ubiquitin thioesterase OTU1 OS=Gallus gallus GN=YO... [more]
OTU1_HUMAN2.733e-4749.03Ubiquitin thioesterase OTU1 OS=Homo sapiens GN=YOD... [more]
OTU1_MOUSE6.088e-4747.57Ubiquitin thioesterase OTU1 OS=Mus musculus GN=Yod... [more]
OTU1_DROME2.313e-4645.15Ubiquitin thioesterase OTU1 OS=Drosophila melanoga... [more]
OTU1_RAT3.021e-4647.57Ubiquitin thioesterase OTU1 OS=Rattus norvegicus G... [more]
OTU1_BOVIN6.731e-4647.57Ubiquitin thioesterase OTU1 OS=Bos taurus GN=YOD1 ... [more]
OTU1_XENLA9.720e-4546.83Ubiquitin thioesterase OTU1 OS=Xenopus laevis GN=y... [more]
OTU1_DROPS3.127e-4341.75Ubiquitin thioesterase OTU1 OS=Drosophila pseudoob... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01N17_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01N17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832433 ID=CF832433|Name=CF832433|organism=Citrus sinensis|type=EST|length=739bp
TTGTCAAGCAAGAACTGATGATATTACCTTAACAAGAACAGAAGCACATC
CAGTCAGTATTGCTATATAAGATGGAAGGTATTATTGTTAGAAGGGTTAT
TCCCTCAGACAACAGTTGCCTATTTAATGCTGTCGGGTATGTTATGGAAC
ATGACAAAAACAAAGCTCCTGAATTGAGACAGGTTATAGCAGCAACAGTA
GCAAGTGATCCAGTAAAATATTCTGAGGCATTTCTTGGAAAGTCAAATCA
AGAGTATTGTTCTTGGATTCAGGACCCAGAGAAGTGGGGAGGTGCCATTG
AGCTTTCGATATTAGCAGATTATTATGGACGTGAAATTGCAGCATATGAT
ATTCAGACCACAAGATGTGATTTGTATGGCCAGGAAAAGAAGTATTCTGA
AAGAGTTATGCTCATCTACGACGGGCTTCATTATGATGCTTTAGCTATAT
CTCCATTTGAGGGAGCTCCAGAGGAGTTTGATCAGACTATATTTCCCGTA
CAGAAGGGCAGGACCATTGGGCCAGCAGAAGACCTAGCTCTGAAACTTGT
CAAGGAGCAGCAAAGGAAAAAGACCTATACCGACACGGCCAACTTCACTT
TGCGCTGTGGGGTATGCCAAATTGGAGTAATTGGACAGAAGGAGGCTGTT
GAGCATGCTCAAGCGACTGGCCATGTCAATTTTCAGGAATATAGATGATA
TGGTAACCGTGTAGCAAAAGTAATCCATTTTATCAGTTA
back to top